PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo2G0001800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 103aa MW: 11870.4 Da PI: 10.5025 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 101.7 | 1.5e-31 | 11 | 95 | 76 | 160 |
YABBY 76 kveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknW 160 + +++nl+s ++ + s+s+ s+ + n+ e+ +++ + rPPekrqrvPs+ynrfikeeiqrika+nP ishreafs aakn Spipo2G0001800 11 QLQSHNLRSLGYSHMCGSSSRGSTIPTINSAENDQHQLLIRRPPEKRQRVPSTYNRFIKEEIQRIKANNPAISHREAFSSAAKNI 95 44555555555555555555555444455555555666699******************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 8.7E-30 | 28 | 94 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 4.04E-5 | 50 | 90 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
YLTLFSMEYQ QLQSHNLRSL GYSHMCGSSS RGSTIPTINS AENDQHQLLI RRPPEKRQRV 60 PSTYNRFIKE EIQRIKANNP AISHREAFSS AAKNISGRFI YLS |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010247861.1 | 2e-30 | PREDICTED: putative axial regulator YABBY 2 isoform X2 | ||||
Swissprot | Q10FZ7 | 4e-25 | YAB2_ORYSJ; Protein YABBY 2 | ||||
TrEMBL | A0A1D1Z4Z6 | 7e-33 | A0A1D1Z4Z6_9ARAE; Protein YABBY 2 | ||||
STRING | XP_008778120.1 | 7e-30 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1394 | 37 | 121 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 8e-27 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo2G0001800 |