PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G26580.2 | ||||||||
Common Name | T9J22.25, YAB5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 164aa MW: 18505.2 Da PI: 9.6388 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 76.7 | 7.6e-24 | 5 | 62 | 4 | 61 |
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61 + ++eq+Cy+ CnfCn ilav+vP +slf +vtvrCGhCt+l svn+a a q l+ + AT2G26580.2 5 VMATEQLCYIPCNFCNIILAVNVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSRPN 62 6789*******************************************99998887654 PP | |||||||
2 | YABBY | 134.5 | 1.3e-41 | 71 | 153 | 87 | 170 |
YABBY 87 ekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 ++ s+s+s+++ s+ +++ ++++ v+rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl AT2G26580.2 71 PEYGSSSRSHTKIP-SRISTRTITEQRIVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 153 44444555544433.6777888888888******************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 3.7E-69 | 7 | 153 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 3.67E-8 | 97 | 146 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 1.0E-4 | 100 | 147 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:1902183 | Biological Process | regulation of shoot apical meristem development | ||||
GO:2000024 | Biological Process | regulation of leaf development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MANSVMATEQ LCYIPCNFCN IILAVNVPCS SLFDIVTVRC GHCTNLWSVN MAAALQSLSR 60 PNFQATNYAV PEYGSSSRSH TKIPSRISTR TITEQRIVNR PPEKRQRVPS AYNQFIKEEI 120 QRIKANNPDI SHREAFSTAA KNWAHFPHIH FGLMLESNKQ AKIA |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.38874 | 0.0 | seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 245029_at | 5e-95 | ||||
Expression Atlas | AT2G26580 | - | ||||
AtGenExpress | AT2G26580 | - | ||||
ATTED-II | AT2G26580 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G26580.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator (A: Activate/R: Repress) | |||||
ATRM | AT1G65620 (R), AT2G37630 (R) |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: Leaves polarity and growth defects. {ECO:0000269|PubMed:19837869}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G26580 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK119091 | 0.0 | AK119091.1 Arabidopsis thaliana At2g26580 mRNA for unknown protein, complete cds, clone: RAFL21-44-F19. | |||
GenBank | BT003734 | 0.0 | BT003734.1 Arabidopsis thaliana At2g26580 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_850080.1 | 1e-120 | plant-specific transcription factor YABBY family protein | ||||
Refseq | NP_850081.1 | 1e-120 | plant-specific transcription factor YABBY family protein | ||||
Swissprot | Q8GW46 | 1e-121 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A178VPK4 | 1e-119 | A0A178VPK4_ARATH; YAB5 | ||||
STRING | AT2G26580.1 | 1e-120 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G26580.2 |
Entrez Gene | 817199 |
iHOP | AT2G26580 |
wikigenes | AT2G26580 |