PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo1G0015100 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 184aa MW: 20354.2 Da PI: 11.5013 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 55.9 | 5.6e-18 | 107 | 141 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C +C + +Tp+WR gp+g+ktLCnaCG+++++ +l Spipo1G0015100 107 CWHCAAEETPQWRAGPEGPKTLCNACGVRFKSGRL 141 99*****************************9885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 1.0E-14 | 101 | 151 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 11.82 | 101 | 137 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 4.8E-15 | 101 | 138 | IPR013088 | Zinc finger, NHR/GATA-type |
SuperFamily | SSF57716 | 2.42E-14 | 103 | 164 | No hit | No description |
CDD | cd00202 | 1.11E-12 | 106 | 154 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 107 | 132 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 8.1E-16 | 107 | 141 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MVSSQAFVEE DLEWLSNKDA FPSLDTFLSV PNRPSPPAPA LAGAKRPSPV SVLDGAPPPP 60 PPLVLQWAAG RARSRGRRRR RRDLRAFRGR SPEEAAPSRA PREKRRCWHC AAEETPQWRA 120 GPEGPKTLCN ACGVRFKSGR LVPEYRPASS PTFSSDLHSN SHRKIMEMRR RNLEELGTAA 180 KKG* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 70 | 80 | RARSRGRRRRR |
2 | 72 | 81 | RSRGRRRRRR |
3 | 74 | 81 | RGRRRRRR |
4 | 76 | 84 | RRRRRRDLR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008368588.2 | 2e-49 | GATA transcription factor 1 | ||||
Refseq | XP_028952110.1 | 2e-49 | GATA transcription factor 1 | ||||
Refseq | XP_028952111.1 | 2e-49 | GATA transcription factor 1 | ||||
Swissprot | P69781 | 3e-37 | GAT12_ARATH; GATA transcription factor 12 | ||||
TrEMBL | A0A1D1Y699 | 3e-61 | A0A1D1Y699_9ARAE; GATA transcription factor 12 (Fragment) | ||||
STRING | XP_009365479.1 | 1e-48 | (Pyrus x bretschneideri) | ||||
STRING | EOY05429 | 1e-48 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5962 | 36 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24050.1 | 6e-38 | GATA transcription factor 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo1G0015100 |
Publications ? help Back to Top | |||
---|---|---|---|
|