PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G24050.1 | ||||||||
Common Name | F14O13.24, GATA1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 274aa MW: 30113.7 Da PI: 7.4373 | ||||||||
Description | GATA transcription factor 1 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 61.3 | 1.2e-19 | 196 | 230 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +l AT3G24050.1 196 CQHCGAEKTPQWRAGPAGPKTLCNACGVRYKSGRL 230 *******************************9885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 8.8E-15 | 190 | 240 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 8.08E-15 | 193 | 253 | No hit | No description |
PROSITE profile | PS50114 | 12.07 | 193 | 226 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.9E-15 | 194 | 228 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.41E-14 | 195 | 242 | No hit | No description |
Pfam | PF00320 | 3.0E-17 | 196 | 230 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 196 | 221 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 274 aa Download sequence Send to blast |
MEMESFMDDL LNFSVPEEEE DDDEHTQPPR NITRRKTGLR PTDSFGLFNT DDLGVVEEED 60 LEWISNKNAF PVIETFVGVL PSEHFPITSL LEREATEVKQ LSPVSVLETS SHSSTTTTSN 120 SSGGSNGSTA VATTTTTPTI MSCCVGFKAP AKARSKRRRT GRRDLRVLWT GNEQGGIQKK 180 KTMTVAAAAL IMGRKCQHCG AEKTPQWRAG PAGPKTLCNA CGVRYKSGRL VPEYRPANSP 240 TFTAELHSNS HRKIVEMRKQ YQSGDGDGDR KDCG |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.24370 | 0.0 | cell culture| flower| leaf| root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145338884 | 0.0 | ||||
Genevisible | 256916_at | 0.0 | ||||
Expression Atlas | AT3G24050 | - | ||||
AtGenExpress | AT3G24050 | - | ||||
ATTED-II | AT3G24050 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in stems, flowers and leaves. {ECO:0000269|PubMed:12139008}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a member of the GATA factor family of zinc finger transcription factors. | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00377 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G24050.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G24050 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT024497 | 0.0 | BT024497.1 Arabidopsis thaliana At3g24050 mRNA, complete cds. | |||
GenBank | Y13648 | 0.0 | Y13648.1 Arabidopsis thaliana mRNA for GATA transcription factor 1. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_189047.1 | 0.0 | GATA transcription factor 1 | ||||
Swissprot | Q8LAU9 | 0.0 | GATA1_ARATH; GATA transcription factor 1 | ||||
TrEMBL | A0A384KMY5 | 0.0 | A0A384KMY5_ARATH; GATA1 | ||||
TrEMBL | Q2HIT4 | 0.0 | Q2HIT4_ARATH; At3g24050 | ||||
STRING | AT3G24050.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12987 | 24 | 30 | Representative plant | OGRP68 | 17 | 287 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G24050.1 |
Entrez Gene | 821990 |
iHOP | AT3G24050 |
wikigenes | AT3G24050 |