PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo18G0035000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 184aa MW: 20971.8 Da PI: 9.9711 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.6 | 1.2e-17 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd llv++++ +G g+W+ ar g++Rt+k+c++rw++yl Spipo18G0035000 17 RGPWTLEEDSLLVHYITCHGEGRWNHLARSSGLKRTGKSCRLRWLNYL 64 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.8 | 9.1e-17 | 70 | 113 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE+ l++d++ ++G++ W++Ia+ ++ gRt++++k++w++ Spipo18G0035000 70 RGNLTPEEQILILDLHSKWGNR-WSRIAQQLP-GRTDNEIKNYWRT 113 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.432 | 12 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.72E-30 | 14 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.2E-13 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-14 | 17 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.8E-22 | 18 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.34E-10 | 19 | 64 | No hit | No description |
PROSITE profile | PS51294 | 24.975 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-14 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.5E-15 | 70 | 113 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.0E-24 | 72 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.26E-11 | 74 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009686 | Biological Process | gibberellin biosynthetic process | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MSNKPALKFD EHVELRRGPW TLEEDSLLVH YITCHGEGRW NHLARSSGLK RTGKSCRLRW 60 LNYLKPDVKR GNLTPEEQIL ILDLHSKWGN RWSRIAQQLP GRTDNEIKNY WRTRVQKQAR 120 QLNVDANSAV FRNALPCFCT TAVNPAPALG SAAPYGGGDN AVGDGVWSID ELWEFRKQHK 180 WGI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 8e-26 | 14 | 119 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00216 | DAP | Transfer from AT1G68320 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020251872.1 | 3e-79 | LOW QUALITY PROTEIN: transcription factor MYB62-like | ||||
Swissprot | Q9C9G7 | 5e-69 | MYB62_ARATH; Transcription factor MYB62 | ||||
TrEMBL | A0A1D1YZ87 | 3e-78 | A0A1D1YZ87_9ARAE; Transcription factor MYB21 (Fragment) | ||||
STRING | XP_008807088.1 | 3e-77 | (Phoenix dactylifera) | ||||
STRING | GSMUA_Achr3P21060_001 | 3e-77 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP198 | 38 | 330 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68320.1 | 2e-71 | myb domain protein 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo18G0035000 |
Publications ? help Back to Top | |||
---|---|---|---|
|