PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G68320.1 | ||||||||
Common Name | AtMYB62, BW62B, BW62C, MYB62, T22E19.5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 286aa MW: 33239.1 Da PI: 5.8705 | ||||||||
Description | myb domain protein 62 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.8 | 9.2e-17 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd ll +++ G g+W+ +a++ g++Rt+k+c++rw++yl AT1G68320.1 21 RGPWTLEEDTLLTNYILHNGEGRWNHVAKCAGLKRTGKSCRLRWLNYL 68 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.9 | 1.7e-16 | 74 | 117 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++ AT1G68320.1 74 RGNLTPQEQLLILELHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.083 | 16 | 68 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.44E-30 | 19 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3E-14 | 20 | 70 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-15 | 21 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.4E-22 | 22 | 75 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.35E-10 | 23 | 68 | No hit | No description |
PROSITE profile | PS51294 | 25.264 | 69 | 123 | IPR017930 | Myb domain |
SMART | SM00717 | 1.4E-14 | 73 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-15 | 74 | 117 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.8E-23 | 76 | 122 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.08E-11 | 78 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0009686 | Biological Process | gibberellin biosynthetic process | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 286 aa Download sequence Send to blast |
MENSMKKKKS FKESEDEELR RGPWTLEEDT LLTNYILHNG EGRWNHVAKC AGLKRTGKSC 60 RLRWLNYLKP DIRRGNLTPQ EQLLILELHS KWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ 120 KQARQLNIES NSDKFFDAVR SFWVPRLIEK MEQNSSTTTT YCCPQNNNNN SLLLPSQSHD 180 SLSMQKDIDY SGFSNIDGSS STSTCMSHLT TVPHFMDQSN TNIIDGSMCF HEGNVQEFGG 240 YVPGMEDYMV NSDISMECHV ADGYSAYEDV TQDPMWNVDD IWQFRE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-24 | 18 | 123 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30697659 | 0.0 | ||||
Genevisible | 260435_at | 0.0 | ||||
Expression Atlas | AT1G68320 | - | ||||
AtGenExpress | AT1G68320 | - | ||||
ATTED-II | AT1G68320 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves and flowers. {ECO:0000269|PubMed:19529828}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | putative transcription factor: R2R3-MYB transcription family. Involved in regulation of phosphate starvation responses and gibberellic acid biosynthesis. | |||||
UniProt | Transcription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00216 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G68320.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | salicylic acid |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G68320 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519568 | 0.0 | AY519568.1 Arabidopsis thaliana MYB transcription factor (At1g68320) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_176999.1 | 0.0 | myb domain protein 62 | ||||
Swissprot | Q9C9G7 | 0.0 | MYB62_ARATH; Transcription factor MYB62 | ||||
TrEMBL | A0A178WLK6 | 0.0 | A0A178WLK6_ARATH; MYB62 | ||||
STRING | AT1G68320.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2632 | 25 | 71 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G68320.1 |
Entrez Gene | 843161 |
iHOP | AT1G68320 |
wikigenes | AT1G68320 |