PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo0G0112300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 222aa MW: 24879.3 Da PI: 8.7493 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 120.1 | 2e-37 | 9 | 129 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevd.iykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrFhPtdeelv +yL++kv +++l++ vi+e++ + +++PwdLp + eke yfF+ +k++ + ++ra +sgyWk tg+++e+++ Spipo0G0112300 9 LPPGFRFHPTDEELVLQYLQRKVFSRPLPA-AVIPELElLSRYDPWDLPGC---PEKERYFFCIMPEKQR--RCPHRA-SSGYWKPTGRSREIIA 96 79****************************.89****725678******54...6789******999875..466775.78************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++vg kk+Lvf + ++g++tdW+mheyrl Spipo0G0112300 97 -CNQVVGAKKSLVFNLWKGSNGSRTDWFMHEYRL 129 .999***********99***************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.53E-44 | 6 | 156 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 44.335 | 9 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-22 | 10 | 129 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MAREGAVRLP PGFRFHPTDE ELVLQYLQRK VFSRPLPAAV IPELELLSRY DPWDLPGCPE 60 KERYFFCIMP EKQRRCPHRA SSGYWKPTGR SREIIACNQV VGAKKSLVFN LWKGSNGSRT 120 DWFMHEYRLA GIFFQQKKLS LGPSAEEWVL CRIFRKRRAG KGGAAVEGGA ERCRLPNQIA 180 LGSLPSDSES SCVTEEASDD DGEDGSCRSS SSPSLSPRRD P* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-33 | 7 | 161 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-33 | 7 | 161 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-33 | 7 | 161 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-33 | 7 | 161 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-32 | 7 | 161 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-32 | 7 | 161 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-32 | 7 | 161 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-32 | 7 | 161 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-32 | 7 | 161 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-32 | 7 | 161 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-32 | 7 | 161 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-32 | 7 | 161 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 8e-33 | 7 | 161 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 8e-33 | 7 | 161 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008777977.1 | 1e-60 | NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 2e-52 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A2H3X402 | 2e-59 | A0A2H3X402_PHODC; NAC domain-containing protein 83-like | ||||
STRING | XP_008777977.1 | 4e-60 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP11818 | 31 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 1e-51 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo0G0112300 |
Publications ? help Back to Top | |||
---|---|---|---|
|