PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0032200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family ARF
Protein Properties Length: 754aa    MW: 82130.4 Da    PI: 6.1565
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0032200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.41.2e-22110211199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++p++ ae++       + +++  ++l+ +d++  sW++++iyr++++r++lt+GW+ Fv  ++L +gD+v+F   +++
  Spipo0G0032200 110 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QELSAKDLHDASWTFRHIYRGQPKRHLLTTGWSVFVGTKRLLAGDSVLFV--RDE 200
                     99*****************************954.4444.48************************************************..456 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     + +l+++v+r+
  Spipo0G0032200 201 KSQLLLGVRRA 211
                     77789999986 PP

2Auxin_resp119.13.5e-39236318183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     aahaa+++s+F+v+YnPra++seFv++++k+ ka +++vsvGmRf+m+fete+s  rr++Gt++g+sdldp rW+nS+Wr+L+
  Spipo0G0032200 236 AAHAAANNSPFTVFYNPRATPSEFVIPLAKYYKAAYTQVSVGMRFRMMFETEESGIRRYMGTITGISDLDPDRWRNSHWRNLQ 318
                     79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.97E-4398239IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.2E-40102225IPR015300DNA-binding pseudobarrel domain
CDDcd100176.84E-19109210No hitNo description
SMARTSM010191.7E-21110212IPR003340B3 DNA binding domain
PROSITE profilePS5086311.744110212IPR003340B3 DNA binding domain
PfamPF023621.6E-20110211IPR003340B3 DNA binding domain
PfamPF065073.6E-35236318IPR010525Auxin response factor
PfamPF023091.1E-8617713IPR033389AUX/IAA domain
PROSITE profilePS5174523.6627711IPR000270PB1 domain
SuperFamilySSF542772.26E-7641706No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MAADMGLHQN EGSVERVLSE PCRSLVVYFP QGHSEQVAAS MHKDTDSIPS YPSLPSKLIC  60
LLHNVTLHAD PETDEVYAEM TLQPVSKCDR EAFLASDLAL KQNRQPSEFF CKTLTASDTS  120
THGGFSVPRR AAEKIFPPLD FSMQPPAQEL SAKDLHDASW TFRHIYRGQP KRHLLTTGWS  180
VFVGTKRLLA GDSVLFVRDE KSQLLLGVRR AVRQPPSLSS SVLSSDSMHI GILAAAAHAA  240
ANNSPFTVFY NPRATPSEFV IPLAKYYKAA YTQVSVGMRF RMMFETEESG IRRYMGTITG  300
ISDLDPDRWR NSHWRNLQVG WDESAAGERR NRVSVWEIEP VATPFYLCPP FFRPKLPRLP  360
GMLDEDGEVE SGLKRGGGWA GEEGQGPILA GLNLMQWMSM QQGPQSMASA AAAQAGLFQA  420
LEKPSGPLLS PTSPKHHQQF KPQIEGPLGL PSSKAQPGPP LMPPAEPPAG NLLHELRCRP  480
DPCIKNDAHC AREAEHPTGY RQGTTDQLDA SSSATSFCLD GGAAQESFSL PPLCLDSDIA  540
NVGLSPDALL LKGFSSGRDL QGLLMTGYGG SQRDPEPEIS SQSFGVPGIS YRASSSGEAA  600
AAAAGGPANE NGALNRGLWA GQQHRMRTYT KVQKRGSVGR CIDVTRYKGY GELRRDLAAM  660
FGIEGQLEDP HRTDWKLVYV DHENDILLVG DDPWEEFVSC VQSIKILSAA EVQQMSLDNL  720
VNAPSENPAC SGSDNGNIWK VHYDDNSGAS FGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1502433971388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273878.10.0PREDICTED: auxin response factor 7-like
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLA0A1R3IUW20.0A0A1R3IUW2_9ROSI; Auxin response factor
STRINGPavir.Db01975.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]