PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g011260.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 589aa    MW: 64525.6 Da    PI: 4.8598
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g011260.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS457.58.4e-1401995741374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         lv++L++cAeav++++l+la++l+ ++  la ++  +m+++a+yf+eALa+r+++        + p+++ e++ +++l++   f+e++P+l
  Sopim11g011260.0.1 199 LVHTLMACAEAVQQENLTLADQLVRHIGILAVSQSGAMRKVATYFAEALARRIYK--------IYPQDSMESSYTDVLQM--HFYETCPYL 279
                         689****************************************************........44666654455555444..5******** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         kf+h+taNqaIlea+ g+++vH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae++gv+fef+ +v
  Sopim11g011260.0.1 280 KFAHFTANQAILEAFTGCNKVHVIDFSLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLAETIGVEFEFRGFV 370
                         ******************************************************************************************* PP

                GRAS 183 akrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         a++l+dl+   L+++p   Ea+a+n+v++lhrll++++++e+    vL+ +k+++Pk+v++veqea+hn++ F +rf eal+yys++fdsl
  Sopim11g011260.0.1 371 ANSLADLDATILDIRPseTEAVAINSVFELHRLLSRPGAIEK----VLNSIKQINPKIVTLVEQEANHNAGVFIDRFNEALHYYSTMFDSL 457
                         ***************99999**************99999999....********************************************* PP

                GRAS 272 eak.............lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdg 348
                         e++              p+ ++++ ++++++lgr+i+nvvaceg++r+erhetl++Wr r++++GF pv+l+++a kqa++ll+ ++ +dg
  Sopim11g011260.0.1 458 ESSgssssasptgilpQPPVNNQDLVMSEVYLGRQICNVVACEGSDRVERHETLNQWRVRMNSSGFDPVHLGSNAFKQASMLLALFAgGDG 548
                         9999**********7777778********************************************************************** PP

                GRAS 349 yrveeesgslvlgWkdrpLvsvSaWr 374
                         yrvee++g+l+lgW++rpL+++SaW+
  Sopim11g011260.0.1 549 YRVEENDGCLMLGWHTRPLIATSAWK 574
                         *************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.0E-3342107IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.0E-3142115No hitNo description
PROSITE profilePS5098568.281173553IPR005202Transcription factor GRAS
PfamPF035142.9E-137199574IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MKRDRDRDRE REKRAFSNGA VSSGKSKIWE EDEEEKPDAG MDELLAVLGY KVKSSDMADV  60
AQKLEQLEMA MGTTMEDGIT HLSTDTVHKN PSDMAGWVQS MLSSISTNFD MCNQENDVLV  120
SGCGSSSSII DFSQNHRTST ISDDDLRAIP GGAVFNSDSN KRHRSTTSSF STTSSSMVTD  180
SSATRPVVLV DSQETGVRLV HTLMACAEAV QQENLTLADQ LVRHIGILAV SQSGAMRKVA  240
TYFAEALARR IYKIYPQDSM ESSYTDVLQM HFYETCPYLK FAHFTANQAI LEAFTGCNKV  300
HVIDFSLKQG MQWPALMQAL ALRPGGPPAF RLTGIGPPQP DNTDALQQVG WKLAQLAETI  360
GVEFEFRGFV ANSLADLDAT ILDIRPSETE AVAINSVFEL HRLLSRPGAI EKVLNSIKQI  420
NPKIVTLVEQ EANHNAGVFI DRFNEALHYY STMFDSLESS GSSSSASPTG ILPQPPVNNQ  480
DLVMSEVYLG RQICNVVACE GSDRVERHET LNQWRVRMNS SGFDPVHLGS NAFKQASMLL  540
ALFAGGDGYR VEENDGCLML GWHTRPLIAT SAWKLLPDSG TGAGEVEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A5e-6819457314378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234365.10.0DELLA protein GAI
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLA0A0V0IPK90.0A0A0V0IPK9_SOLCH; Putative DELLA protein GAI-like
STRINGSolyc11g011260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]