PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00016473-RA_Salv | ||||||||
Common Name | WRKY33 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 175aa MW: 19944.4 Da PI: 9.7349 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.4 | 1.1e-31 | 96 | 154 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+++r ++d++vv++tYeg Hnh+ SMil_00016473-RA_Salv 96 LDDGYKWRKYGQKSVKNSVHPRSYYRCTHHTCNVKKQIQRLSKDNSVVVTTYEGIHNHP 154 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.4E-32 | 83 | 154 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.4E-28 | 88 | 155 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.449 | 91 | 156 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.3E-35 | 96 | 155 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.6E-25 | 97 | 154 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MEGENFPYFF GSSPFPLSGS STNVLEQSMQ NPSFPSSDQM DLASLLSAGS IEQNPGSTAS 60 REVDQNGSRS KSRFGKKKKY VPQRVAFHTR SEEDILDDGY KWRKYGQKSV KNSVHPRSYY 120 RCTHHTCNVK KQIQRLSKDN SVVVTTYEGI HNHPCEKLME TLSPLLKQLQ FLSRF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-24 | 86 | 153 | 7 | 74 | Probable WRKY transcription factor 4 |
2ayd_A | 4e-24 | 84 | 153 | 2 | 71 | WRKY transcription factor 1 |
2lex_A | 5e-24 | 86 | 153 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00539 | DAP | Transfer from AT5G41570 | Download |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM823156 | 0.0 | KM823156.1 Salvia miltiorrhiza WRKY protein (WRKY33) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011081140.1 | 1e-84 | probable WRKY transcription factor 43 | ||||
Swissprot | Q8VWQ4 | 2e-58 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | A0A0D5Y9A2 | 1e-128 | A0A0D5Y9A2_SALMI; WRKY protein | ||||
STRING | Migut.A00716.1.p | 4e-82 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6374 | 24 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 4e-60 | WRKY DNA-binding protein 56 |