PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G64000.1 | ||||||||
Common Name | ATWRKY56, F22C12.23, WRKY56 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 195aa MW: 21774.4 Da PI: 8.2183 | ||||||||
Description | WRKY DNA-binding protein 56 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.9 | 8.9e-33 | 113 | 171 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dp+vv++tYeg Hnh+ AT1G64000.1 113 LDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGVHNHP 171 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.0E-32 | 100 | 171 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.31E-28 | 105 | 172 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.241 | 108 | 173 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.0E-38 | 113 | 172 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.8E-26 | 114 | 171 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MEGVDNTNPM LTLEEGENNN PFSSLDDKTL MMMAPSLIFS GDVGPSSSSC TPAGYHLSAQ 60 LENFRGGGGE MGGLVSNNSN NSDHNKNCNK GKGKRTLAMQ RIAFHTRSDD DVLDDGYRWR 120 KYGQKSVKNN AHPRSYYRCT YHTCNVKKQV QRLAKDPNVV VTTYEGVHNH PCEKLMETLS 180 PLLRQLQFLS RVSDL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 103 | 170 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 103 | 170 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30696945 | 0.0 | ||||
Genevisible | 262339_at | 0.0 | ||||
Expression Atlas | AT1G64000 | - | ||||
AtGenExpress | AT1G64000 | - | ||||
ATTED-II | AT1G64000 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | member of WRKY Transcription Factor; Group II-c | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G64000.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G64000 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY071848 | 0.0 | AY071848.1 Arabidopsis thaliana WRKY transcription factor 56 (WRKY56) mRNA, complete cds. | |||
GenBank | BT024835 | 0.0 | BT024835.1 Arabidopsis thaliana At1g64000 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_176583.1 | 1e-146 | WRKY DNA-binding protein 56 | ||||
Swissprot | Q8VWQ4 | 1e-147 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | Q29PS1 | 1e-145 | Q29PS1_ARATH; At1g64000 | ||||
STRING | AT1G64000.1 | 1e-146 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 | Representative plant | OGRP14 | 17 | 875 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G64000.1 |
Entrez Gene | 842703 |
iHOP | AT1G64000 |
wikigenes | AT1G64000 |
Publications ? help Back to Top | |||
---|---|---|---|
|