PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_35363.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 117aa MW: 13911 Da PI: 10.8245 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.3 | 4.7e-15 | 57 | 104 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W +eEd +l +++ +G g+W I+r g++R +k+c++rw +yl Rsa1.0_35363.1_g00001.1 57 RGLWKPEEDMILRSYIETHGEGNWGDISRNSGLKRGGKSCRLRWKNYL 104 788*****************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.211 | 52 | 108 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.8E-21 | 53 | 114 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.69E-17 | 54 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.1E-13 | 56 | 106 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-13 | 57 | 104 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.74E-10 | 60 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
ISPHMFELKL ETRARYAHLI AKPNTHLTFK PWRGGEKKER MEKKREEEER KSHVVKRGLW 60 KPEEDMILRS YIETHGEGNW GDISRNSGLK RGGKSCRLRW KNYLRPNIKR GGMSPQE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_35363.1_g00001.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018468290.1 | 2e-76 | PREDICTED: transcription factor MYB82-like | ||||
Swissprot | Q9LTF7 | 2e-37 | MYB82_ARATH; Transcription factor MYB82 | ||||
TrEMBL | A0A078JF76 | 3e-38 | A0A078JF76_BRANA; BnaC02g44890D protein | ||||
TrEMBL | A0A3P6DES4 | 3e-38 | A0A3P6DES4_BRAOL; Uncharacterized protein | ||||
STRING | Bo2g047590.1 | 9e-39 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52600.1 | 2e-38 | myb domain protein 82 |