PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G52600.1 | ||||||||
Common Name | AtMYB82, F6N7.8, MYB82 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 201aa MW: 23292.3 Da PI: 9.3837 | ||||||||
Description | myb domain protein 82 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.3 | 2.6e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W +eEd +l+ +v+ +G g+W+ I+r+ g++R +k+c++rw +yl AT5G52600.1 14 RGLWKPEEDMILKSYVETHGEGNWADISRRSGLKRGGKSCRLRWKNYL 61 788*****************************99************97 PP | |||||||
2 | Myb_DNA-binding | 51.9 | 1.7e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++++E++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l AT5G52600.1 67 RGSMSPQEQDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 112 899*******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.392 | 9 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.87E-29 | 13 | 108 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.6E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-22 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.68E-11 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.614 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 4.9E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.7E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.2E-24 | 69 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.00E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0010026 | Biological Process | trichome differentiation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MECKREEGKS YVKRGLWKPE EDMILKSYVE THGEGNWADI SRRSGLKRGG KSCRLRWKNY 60 LRPNIKRGSM SPQEQDLIIR MHKLLGNRWS LIAGRLPGRT DNEVKNYWNT HLNKKPNSRR 120 QNAPESIVGA TPFTDKPVMS TELRRSHGEG GEEESNTWME ETNHFGYDVH VGSPLPLISH 180 YPDNTLVFDP CFSFTDFFPL L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 8e-24 | 14 | 115 | 27 | 127 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30696214 | 0.0 | ||||
Expression Atlas | AT5G52600 | - | ||||
AtGenExpress | AT5G52600 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in the trichomes of new leaves. {ECO:0000269|PubMed:24803498}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Member of the R2R3 factor gene family. | |||||
UniProt | Transcription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G52600.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT5G52600 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G52600 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519637 | 0.0 | AY519637.1 Arabidopsis thaliana MYB transcription factor (At5g52600) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_680426.1 | 1e-150 | myb domain protein 82 | ||||
Swissprot | Q9LTF7 | 1e-151 | MYB82_ARATH; Transcription factor MYB82 | ||||
TrEMBL | A0A178URQ8 | 1e-148 | A0A178URQ8_ARATH; MYB82 | ||||
STRING | AT5G52600.1 | 1e-149 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G52600.1 |
Entrez Gene | 835337 |
iHOP | AT5G52600 |
wikigenes | AT5G52600 |