PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_08399.1_g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 153aa MW: 17280.5 Da PI: 9.191 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51 | 3.4e-16 | 19 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++++E++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l Rsa1.0_08399.1_g00003.1 19 RGGMSPQEQDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 64 6779******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-8 | 2 | 27 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.7E-20 | 2 | 74 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.258 | 14 | 68 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-15 | 18 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-14 | 19 | 64 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.92E-12 | 22 | 64 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.2E-21 | 28 | 65 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
GGKSCRLRWK NYLRPNIKRG GMSPQEQDLI IRMHKLLGNR WSLIAGRLPG RTDNEVKNYW 60 NTHLNKKTNG RKQNATESVE ATTPWVDKPV MSAEVRGIHG GGDGEEGTTT TTWMEETNFF 120 ARIDSPLPLA SHYPSDTLSF DPSFAFTDCF PLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-19 | 2 | 69 | 42 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_08399.1_g00003.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018470563.1 | 1e-112 | PREDICTED: transcription factor MYB82-like | ||||
Swissprot | Q9LTF7 | 2e-80 | MYB82_ARATH; Transcription factor MYB82 | ||||
TrEMBL | A0A078JF76 | 2e-87 | A0A078JF76_BRANA; BnaC02g44890D protein | ||||
STRING | Bra022602.1-P | 9e-84 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52600.1 | 7e-72 | myb domain protein 82 |