PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC7349_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 10063.4 Da PI: 9.2117 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.6 | 1.2e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT eEd++lv +++++G g+W+ +r+ g+ R++k+c++rw++yl RrC7349_p1 14 RGGWTDEEDQKLVAYINEYGIGDWRFLPRKAGLQRCGKSCRLRWLNYL 61 789********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.801 | 9 | 65 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.2E-21 | 10 | 64 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.75E-22 | 15 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.20E-11 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-8 | 65 | 87 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.169 | 66 | 87 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MGRATWFDAD GTKRGGWTDE EDQKLVAYIN EYGIGDWRFL PRKAGLQRCG KSCRLRWLNY 60 LRPGVKKGKF TPEEEEAIIN FHSILGN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-15 | 14 | 87 | 7 | 79 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013638895.1 | 2e-58 | PREDICTED: transcription repressor MYB6-like isoform X1 | ||||
Refseq | XP_013638896.1 | 1e-58 | PREDICTED: transcription factor MYB32-like isoform X2 | ||||
Swissprot | Q9LDR8 | 2e-37 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | A0A078IKZ0 | 3e-57 | A0A078IKZ0_BRANA; BnaC05g50190D protein | ||||
STRING | Bo5g025790.1 | 7e-58 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18710.1 | 4e-48 | myb domain protein 47 |
Publications ? help Back to Top | |||
---|---|---|---|
|