PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G18710.1 | ||||||||
Common Name | AtMYB47, F6a14.18, MYB47 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 267aa MW: 30592.3 Da PI: 5.4615 | ||||||||
Description | myb domain protein 47 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.1 | 6.2e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd++l +++++G +W++ +++ g+ R++k+c++rw++yl AT1G18710.1 14 KGEWTAEEDQKLGAYINEHGVCDWRSLPKRAGLQRCGKSCRLRWLNYL 61 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.5 | 2.6e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T++E+e ++++++ lG++ W++ a++m+ +Rt++++k++w++ AT1G18710.1 67 RGKFTPQEEEEIIQLHAVLGNR-WAAMAKKMQ-NRTDNDIKNHWNSC 111 89********************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.398 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.31E-28 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.8E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.38E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.142 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 4.3E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.7E-16 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.03E-9 | 69 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-24 | 69 | 116 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009047 | anatomy | stem | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 267 aa Download sequence Send to blast |
MGRTTWFDVD GMKKGEWTAE EDQKLGAYIN EHGVCDWRSL PKRAGLQRCG KSCRLRWLNY 60 LKPGIRRGKF TPQEEEEIIQ LHAVLGNRWA AMAKKMQNRT DNDIKNHWNS CLKKRLSRKG 120 IDPMTHEPII KHLTVNTTNA DCGNSSTTTS PSTTESSPSS GSSRLLNKLA AGISSRQHSL 180 DRIKYILSNS IIESSDQAKE EEEKEEEEEE RDSMMGQKID GSEGEDIQIW GEEEVRRLME 240 IDAMDMYEMT SYDAVMYESS HILDHLF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-25 | 9 | 116 | 2 | 108 | B-MYB |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 261431_at | 0.0 | ||||
Expression Atlas | AT1G18710 | - | ||||
AtGenExpress | AT1G18710 | - | ||||
ATTED-II | AT1G18710 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in trichomes, stems, carpels, petals and stamens. {ECO:0000269|PubMed:18805951}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Member of the R2R3 factor gene family. | |||||
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G18710.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | jasmonic acid |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G18710 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY065166 | 0.0 | AY065166.1 Arabidopsis thaliana Putative MYB47 transcription factor (F6a14.18) mRNA, complete cds. | |||
GenBank | AY114579 | 0.0 | AY114579.1 Arabidopsis thaliana Putative MYB47 transcription factor (At1g18710) mRNA, complete cds. | |||
GenBank | AY519556 | 0.0 | AY519556.1 Arabidopsis thaliana MYB transcription factor (At1g18710) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_173306.1 | 0.0 | myb domain protein 47 | ||||
Swissprot | Q9LE63 | 7e-59 | MY106_ARATH; Transcription factor MYB106 | ||||
TrEMBL | A0A178W4W9 | 0.0 | A0A178W4W9_ARATH; MYB47 | ||||
TrEMBL | Q9M9U2 | 0.0 | Q9M9U2_ARATH; MYB transcription factor | ||||
STRING | AT1G18710.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G18710.1 |
Entrez Gene | 838453 |
iHOP | AT1G18710 |
wikigenes | AT1G18710 |