PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC4363_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 237aa MW: 27319.7 Da PI: 8.7794 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.4 | 5.9e-17 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l+d+v+ +G+g W++I r+ g++R++k+c++rw +yl RrC4363_p1 18 KGLWTVEEDNILIDYVQAHGTGLWNRIVRKTGLKRCGKSCRLRWINYL 65 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 57.2 | 3.9e-18 | 71 | 124 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.......-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.......tWktIartmgkgRtlkqcksrwqkyl 48 +g++T++E++l+++++k+lG+ +W++Ia++++ gRt++q+k++w+++l RrC4363_p1 71 KGNFTEQEEDLIIRLHKLLGNSmifsfqsRWSLIAKRVP-GRTDNQVKNHWNTHL 124 79*************************************.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.759 | 13 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.06E-27 | 16 | 120 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.9E-14 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.6E-15 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.5E-23 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.81E-11 | 21 | 65 | No hit | No description |
PROSITE profile | PS51294 | 22.486 | 66 | 128 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-14 | 70 | 126 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-17 | 71 | 124 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.73E-13 | 73 | 124 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.7E-24 | 73 | 127 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MRMRRRSEER ENHQEYKKGL WTVEEDNILI DYVQAHGTGL WNRIVRKTGL KRCGKSCRLR 60 WINYLSPTVN KGNFTEQEED LIIRLHKLLG NSMIFSFQSR WSLIAKRVPG RTDNQVKNHW 120 NTHLSKKFVG DYSSAVKTTG EDNSPASLLI SAATASNRQH QQDKICAKSF DGLVPASYEK 180 LTHSDVVLGN TNHPSLDFKE RNNFDGSNAF WFNEDDFELV SSFAMMDFAS SDIGYYL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-26 | 18 | 128 | 7 | 108 | B-MYB |
1h8a_C | 3e-26 | 15 | 128 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269|PubMed:11063707, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15728674, ECO:0000269|PubMed:9625690}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:9625690}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB747346 | 0.0 | AB747346.1 Raphanus sativus var. niger RsGL1a gene for glabrous 1, complete cds, strain: Ra38 DH line. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018455252.1 | 1e-161 | PREDICTED: trichome differentiation protein GL1-like | ||||
Swissprot | P27900 | 1e-110 | GL1_ARATH; Trichome differentiation protein GL1 | ||||
TrEMBL | K0J1B0 | 1e-156 | K0J1B0_RAPSA; Glabrous 1 | ||||
STRING | Bra025311.1-P | 1e-123 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27920.1 | 1e-108 | myb domain protein 0 |