PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G27920.1

Common Name

ATGL1, ATMYB0, GL1, K16N12.17, MYB0

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 228aa MW: 26338.6 Da PI: 7.1784

Description

myb domain protein 0

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G27920.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53	7.9e-17	16	63	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l d+v +G+g+W++I r+ g++R++k+c++rw +yl AT3G27920.1 16 KGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYL 63 678*******************************************97 PP
2	Myb_DNA-binding	60.7	3.2e-19	69	114	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l AT3G27920.1 69 KGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 114 79******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.446	11	63	IPR017930	Myb domain
SuperFamily	SSF46689	1.25E-30	14	110	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-12	15	65	IPR001005	SANT/Myb domain
Pfam	PF00249	9.2E-15	16	63	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-23	17	70	IPR009057	Homeodomain-like
CDD	cd00167	1.26E-9	19	63	No hit	No description
PROSITE profile	PS51294	28.168	64	118	IPR017930	Myb domain
SMART	SM00717	7.9E-19	68	116	IPR001005	SANT/Myb domain
Pfam	PF00249	2.8E-18	69	114	IPR001005	SANT/Myb domain
CDD	cd00167	4.82E-14	71	114	No hit	No description
Gene3D	G3DSA:1.10.10.60	9.3E-28	71	118	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001708	Biological Process	cell fate specification
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009740	Biological Process	gibberellic acid mediated signaling pathway
GO:0032880	Biological Process	regulation of protein localization
GO:0048629	Biological Process	trichome patterning
GO:2000039	Biological Process	regulation of trichome morphogenesis
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0003677	Molecular Function	DNA binding
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0009006	anatomy	shoot system
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009046	anatomy	flower
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 228 aa Download sequence Send to blast
MRIRRRDEKE NQEYKKGLWT VEEDNILMDY VLNHGTGQWN RIVRKTGLKR CGKSCRLRWM 60 NYLSPNVNKG NFTEQEEDLI IRLHKLLGNR WSLIAKRVPG RTDNQVKNYW NTHLSKKLVG 120 DYSSAVKTTG EDDDSPPSLF ITAATPSSCH HQQENIYENI AKSFNGVVSA SYEDKPKQEL 180 AQKDVLMATT NDPSHYYGNN ALWVHDDDFE LSSLVMMNFA SGDVEYCL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	6e-29	16	118	7	108	B-MYB
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	257221_at	0.0
Expression Atlas	AT3G27920	-
AtGenExpress	AT3G27920	-
ATTED-II	AT3G27920	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Ubiquitous in young leaves primordia. Becomes more prominent in developing trichome cells but disappears progressively when trichomes begin to initiate branches. {ECO:0000269\|PubMed:15728674}.
Uniprot	TISSUE SPECIFICITY: Expressed in leaves, stems and flowers (PubMed:11437443). Expressed in trichome cells and in leaf primordia (PubMed:9625690). {ECO:0000269\|PubMed:11437443, ECO:0000269\|PubMed:9625690}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a Myb-like protein that is required for induction of trichome development.
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269\|PubMed:11063707, ECO:0000269\|PubMed:12356720, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15728674, ECO:0000269\|PubMed:9625690}.

Function -- GeneRIF ? help Back to Top
TRICHOMELESS1 can be recruited to the cis-acting regulatory elements of GLABRA1 [PMID: 17933793] Data show that GL1 associates with TRANSPARENT TESTA GLABRA1 in vivo, forming a complex. [PMID: 18434419] Expression levels of GL1, MYB23, GL2 and TTG1 were reduced in shoots of sad2 mutants while expression levels of GL3 and ENHANCER OF GLABRA3 (EGL3) were enhanced. [PMID: 18713401] DNA binding of GL1 and GL3 via their own DNA-binding domains to the promoter of GL2 is probably required for the activation of GL2 expression. [PMID: 18948276] 20 novel genes in the regulatory network involved in the trichome formation are the direct targets of GL3/GL1. [PMID: 19247443] Impaired fatty acid/lipid flux is associated with a nonallelic GLABRA1 mutation which causes abnormal cuticle formation and impaired plant immunity. [PMID: 20699396] GL1 has qualitative and likely quantitative effects on trichome density in natural populations of Arabidopsis thaliana. [PMID: 22625421] AtMYC1 protein is predominantly localised in the cytoplasm and can relocate GL1 from the nucleus into the cytoplasm. [PMID: 23900543] Protein interaction analysis revealed that MYB82 physically interacts with GLABRA3. In addition, MYB82 and GL1 can form homodimers and heterodimers at R2R3-MYB domains, which may explain why their overexpression reduces trichome numbers. [PMID: 24803498] GL1 represses the activation of the TRY promoter by GL3 and TTG1, and TTG1 suppresses the activation of the CPC promoter by GL1 and GL3. [PMID: 25926482] These results suggested that the Serine 92 in the conserved [D/E]Lx2 [R/K]x3Lx6Lx3R amino acid signature of GL1 is not essential for the interaction of GL1 and GL3, but may play a role in the binding of GL1 to the promoters of its target genes. [PMID: 26667588]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G27920.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269\|PubMed:12535344, ECO:0000269\|PubMed:9625690}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G14920 (R), AT2G01570 (A), AT2G30432 (R), AT3G58070 (A), AT5G06650 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G01380(A), AT1G79840(A), AT2G37260(A), AT2G46410(A), AT4G01060(A), AT5G53200(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	gibberellin, Jasmonic acid

Interaction -- BIND ? help Back to Top
Source	Intact With	Description
BIND	AT1G63650	EGL3 interacts with GL1.
BIND	AT4G00480	MYC1 (AtBHLH012) interacts with GL1.
BIND	AT5G41315	GL3 interacts with GL1.

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G27920, AT4G00480, AT5G40330, AT5G41315, AT5G52600, AT1G14920, AT1G63650
IntAct	Search P27900

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G27920

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519590	0.0	AY519590.1 Arabidopsis thaliana MYB transcription factor (At3g27920) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_189430.1	1e-173	myb domain protein 0
Swissprot	P27900	1e-174	GL1_ARATH; Trichome differentiation protein GL1
TrEMBL	I6P6H3	1e-172	I6P6H3_ARATH; Glabrous 1
STRING	AT3G27920.1	1e-172	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT3G27920.1
Entrez Gene	822415
iHOP	AT3G27920
wikigenes	AT3G27920

Publications ? help Back to Top
Larkin JC,Walker JD,Bolognesi-Winfield AC,Gray JC,Walker AR Allele-specific interactions between ttg and gl1 during trichome development in Arabidopsis thaliana. Genetics, 1999. 151(4): p. 1591-604 [PMID:10101180] Nagata T, et al. Gamma-radiation induces leaf trichome formation in Arabidopsis. Plant Physiol., 1999. 120(1): p. 113-20 [PMID:10318689] Schnittger A,Folkers U,Schwab B,J Generation of a spacing pattern: the role of triptychon in trichome patterning in Arabidopsis. Plant Cell, 1999. 11(6): p. 1105-16 [PMID:10368181] Shikazono N,Tanaka A,Yokota Y,Watanabe H,Tano SM Nucleotide sequence of the GLABROUS1 gene of Arabidopsis thaliana ecotype Columbia. DNA Seq., 1998. 9(3): p. 177-81 [PMID:10520748] Payne CT,Zhang F,Lloyd AM GL3 encodes a bHLH protein that regulates trichome development in arabidopsis through interaction with GL1 and TTG1. Genetics, 2000. 156(3): p. 1349-62 [PMID:11063707] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Shikazono N,Tanaka A,Watanabe H,Tano S Rearrangements of the DNA in carbon ion-induced mutants of Arabidopsis thaliana. Genetics, 2001. 157(1): p. 379-87 [PMID:11139518] Lee MM,Schiefelbein J Developmentally distinct MYB genes encode functionally equivalent proteins in Arabidopsis. Development, 2001. 128(9): p. 1539-46 [PMID:11290293] Kirik V, et al. Ectopic expression of the Arabidopsis AtMYB23 gene induces differentiation of trichome cells. Dev. Biol., 2001. 235(2): p. 366-77 [PMID:11437443] Hauser MT,Harr B,Schl Trichome distribution in Arabidopsis thaliana and its close relative Arabidopsis lyrata: molecular analysis of the candidate gene GLABROUS1. Mol. Biol. Evol., 2001. 18(9): p. 1754-63 [PMID:11504855] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Sawa S Overexpression of the AtmybL2 gene represses trichome development in Arabidopsis. DNA Res., 2002. 9(2): p. 31-4 [PMID:12056412] Larkin JC,Oppenheimer DG,Lloyd AM,Paparozzi ET,Marks MD Roles of the GLABROUS1 and TRANSPARENT TESTA GLABRA Genes in Arabidopsis Trichome Development. Plant Cell, 1994. 6(8): p. 1065-1076 [PMID:12244266] Larkin JC,Oppenheimer DG,Pollock S,Marks MD Arabidopsis GLABROUS1 Gene Requires Downstream Sequences for Function. Plant Cell, 1993. 5(12): p. 1739-1748 [PMID:12271054] Schellmann S, et al. TRIPTYCHON and CAPRICE mediate lateral inhibition during trichome and root hair patterning in Arabidopsis. EMBO J., 2002. 21(19): p. 5036-46 [PMID:12356720] Marks MD,Feldmann KA Trichome Development in Arabidopsis thaliana. I. T-DNA Tagging of the GLABROUS1 Gene. Plant Cell, 1989. 1(11): p. 1043-1050 [PMID:12359885] Herman PL,Marks MD Trichome Development in Arabidopsis thaliana. II. Isolation and Complementation of the GLABROUS1 Gene. Plant Cell, 1989. 1(11): p. 1051-1055 [PMID:12359886] Schiefelbein J Cell-fate specification in the epidermis: a common patterning mechanism in the root and shoot. Curr. Opin. Plant Biol., 2003. 6(1): p. 74-8 [PMID:12495754] Curaba J,Herzog M,Vachon G GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1. Plant J., 2003. 33(2): p. 305-17 [PMID:12535344] Zhang F,Gonzalez A,Zhao M,Payne CT,Lloyd A A network of redundant bHLH proteins functions in all TTG1-dependent pathways of Arabidopsis. Development, 2003. 130(20): p. 4859-69 [PMID:12917293] Kurata T, et al. The YORE-YORE gene regulates multiple aspects of epidermal cell differentiation in Arabidopsis. Plant J., 2003. 36(1): p. 55-66 [PMID:12974811] Esch JJ, et al. A contradictory GLABRA3 allele helps define gene interactions controlling trichome development in Arabidopsis. Development, 2003. 130(24): p. 5885-94 [PMID:14561633] Wang S, et al. Control of plant trichome development by a cotton fiber MYB gene. Plant Cell, 2004. 16(9): p. 2323-34 [PMID:15316114] Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. Plant J., 2004. 40(1): p. 22-34 [PMID:15361138] Reymond P, et al. A conserved transcript pattern in response to a specialist and a generalist herbivore. Plant Cell, 2004. 16(11): p. 3132-47 [PMID:15494554] Esch JJ,Chen MA,Hillestad M,Marks MD Comparison of TRY and the closely related At1g01380 gene in controlling Arabidopsis trichome patterning. Plant J., 2004. 40(6): p. 860-9 [PMID:15584952] Kirik V, et al. Functional diversification of MYB23 and GL1 genes in trichome morphogenesis and initiation. Development, 2005. 132(7): p. 1477-85 [PMID:15728674] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Gruber MY, et al. "HAIRY CANOLA"--Arabidopsis GL3 induces a dense covering of trichomes on Brassica napus seedlings. Plant Mol. Biol., 2006. 60(5): p. 679-98 [PMID:16649106] Gan Y, et al. GLABROUS INFLORESCENCE STEMS modulates the regulation by gibberellins of epidermal differentiation and shoot maturation in Arabidopsis. Plant Cell, 2006. 18(6): p. 1383-95 [PMID:16679458] Calo L,Garc Leaf hairs influence phytopathogenic fungus infection and confer an increased resistance when expressing a Trichoderma alpha-1,3-glucanase. J. Exp. Bot., 2006. 57(14): p. 3911-20 [PMID:17043085] Gan Y,Yu H,Peng J,Broun P Genetic and molecular regulation by DELLA proteins of trichome development in Arabidopsis. Plant Physiol., 2007. 145(3): p. 1031-42 [PMID:17704233] Ishida T, et al. Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation. Plant Cell, 2007. 19(8): p. 2531-43 [PMID:17766401] Morohashi K, et al. Participation of the Arabidopsis bHLH factor GL3 in trichome initiation regulatory events. Plant Physiol., 2007. 145(3): p. 736-46 [PMID:17885086] Wang S, et al. TRICHOMELESS1 regulates trichome patterning by suppressing GLABRA1 in Arabidopsis. Development, 2007. 134(21): p. 3873-82 [PMID:17933793] Marks MD,Esch J,Herman P,Sivakumaran S,Oppenheimer D A model for cell-type determination and differentiation in plants. Symp. Soc. Exp. Biol., 1991. 45: p. 77-87 [PMID:1843415] Zhao M,Morohashi K,Hatlestad G,Grotewold E,Lloyd A The TTG1-bHLH-MYB complex controls trichome cell fate and patterning through direct targeting of regulatory loci. Development, 2008. 135(11): p. 1991-9 [PMID:18434419] Wang S, et al. Comprehensive analysis of single-repeat R3 MYB proteins in epidermal cell patterning and their transcriptional regulation in Arabidopsis. BMC Plant Biol., 2008. 8: p. 81 [PMID:18644155] Shangguan XX,Xu B,Yu ZX,Wang LJ,Chen XY Promoter of a cotton fibre MYB gene functional in trichomes of Arabidopsis and glandular trichomes of tobacco. J. Exp. Bot., 2008. 59(13): p. 3533-42 [PMID:18711121] Gao Y, et al. SAD2 in Arabidopsis functions in trichome initiation through mediating GL3 function and regulating GL1, TTG1 and GL2 expression. J Integr Plant Biol, 2008. 50(7): p. 906-17 [PMID:18713401] Digiuni S, et al. A competitive complex formation mechanism underlies trichome patterning on Arabidopsis leaves. Mol. Syst. Biol., 2008. 4: p. 217 [PMID:18766177] Wang S,Chen JG Arabidopsis transient expression analysis reveals that activation of GLABRA2 may require concurrent binding of GLABRA1 and GLABRA3 to the promoter of GLABRA2. Plant Cell Physiol., 2008. 49(12): p. 1792-804 [PMID:18948276] Li SF, et al. The Arabidopsis MYB5 transcription factor regulates mucilage synthesis, seed coat development, and trichome morphogenesis. Plant Cell, 2009. 21(1): p. 72-89 [PMID:19136646] Yoshida Y,Sano R,Wada T,Takabayashi J,Okada K Jasmonic acid control of GLABRA3 links inducible defense and trichome patterning in Arabidopsis. Development, 2009. 136(6): p. 1039-48 [PMID:19234066] Morohashi K,Grotewold E A systems approach reveals regulatory circuitry for Arabidopsis trichome initiation by the GL3 and GL1 selectors. PLoS Genet., 2009. 5(2): p. e1000396 [PMID:19247443] Wester K, et al. Functional diversity of R3 single-repeat genes in trichome development. Development, 2009. 136(9): p. 1487-96 [PMID:19336467] Oppenheimer DG,Herman PL,Sivakumaran S,Esch J,Marks MD A myb gene required for leaf trichome differentiation in Arabidopsis is expressed in stipules. Cell, 1991. 67(3): p. 483-93 [PMID:1934056] Kang YH, et al. The MYB23 gene provides a positive feedback loop for cell fate specification in the Arabidopsis root epidermis. Plant Cell, 2009. 21(4): p. 1080-94 [PMID:19395683] Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development. Mol Plant, 2009. 2(4): p. 803-22 [PMID:19626137] Wenger JP,Marks MD E2F and retinoblastoma related proteins may regulate GL1 expression in developing Arabidopsis trichomes. Plant Signal Behav, 2008. 3(6): p. 420-2 [PMID:19704586] Siegal-Gaskins D,Grotewold E,Smith GD The capacity for multistability in small gene regulatory networks. BMC Syst Biol, 2009. 3: p. 96 [PMID:19772572] Yu N, et al. Temporal control of trichome distribution by microRNA156-targeted SPL genes in Arabidopsis thaliana. Plant Cell, 2010. 22(7): p. 2322-35 [PMID:20622149] Xia Y, et al. The glabra1 mutation affects cuticle formation and plant responses to microbes. Plant Physiol., 2010. 154(2): p. 833-46 [PMID:20699396] Qi T, et al. The Jasmonate-ZIM-domain proteins interact with the WD-Repeat/bHLH/MYB complexes to regulate Jasmonate-mediated anthocyanin accumulation and trichome initiation in Arabidopsis thaliana. Plant Cell, 2011. 23(5): p. 1795-814 [PMID:21551388] Symonds VV,Hatlestad G,Lloyd AM Natural allelic variation defines a role for ATMYC1: trichome cell fate determination. PLoS Genet., 2011. 7(6): p. e1002069 [PMID:21695236] Guan X, et al. Activation of Arabidopsis seed hair development by cotton fiber-related genes. PLoS ONE, 2011. 6(7): p. e21301 [PMID:21779324] Zhou Z, et al. Zinc finger protein5 is required for the control of trichome initiation by acting upstream of zinc finger protein8 in Arabidopsis. Plant Physiol., 2011. 157(2): p. 673-82 [PMID:21803862] Kawagoe T,Shimizu KK,Kakutani T,Kudoh H Coexistence of trichome variation in a natural plant population: a combined study using ecological and candidate gene approaches. PLoS ONE, 2011. 6(7): p. e22184 [PMID:21811571] Reisberg EE,Hildebrandt U,Riederer M,Hentschel U Phyllosphere bacterial communities of trichome-bearing and trichomeless Arabidopsis thaliana leaves. Antonie Van Leeuwenhoek, 2012. 101(3): p. 551-60 [PMID:22080429] Valdivia ER, et al. DVL genes play a role in the coordination of socket cell recruitment and differentiation. J. Exp. Bot., 2012. 63(3): p. 1405-12 [PMID:22112938] Gan L,Xia K,Chen JG,Wang S Functional characterization of TRICHOMELESS2, a new single-repeat R3 MYB transcription factor in the regulation of trichome patterning in Arabidopsis. BMC Plant Biol., 2011. 11: p. 176 [PMID:22168948] Zhao X,Qiao XR,Yuan J,Ma XF,Zhang X Nitric oxide inhibits blue light-induced stomatal opening by regulating the K+ influx in guard cells. Plant Sci., 2012. 184: p. 29-35 [PMID:22284707] Zhao H, et al. A single amino acid substitution in IIIf subfamily of basic helix-loop-helix transcription factor AtMYC1 leads to trichome and root hair patterning defects by abolishing its interaction with partner proteins in Arabidopsis. J. Biol. Chem., 2012. 287(17): p. 14109-21 [PMID:22334670] Meyer RC, et al. Heterosis manifestation during early Arabidopsis seedling development is characterized by intermediate gene expression and enhanced metabolic activity in the hybrids. Plant J., 2012. 71(4): p. 669-83 [PMID:22487254] Hirano T, et al. Molecular nature of mutations induced by high-LET irradiation with argon and carbon ions in Arabidopsis thaliana. Mutat. Res., 2012. 735(1-2): p. 19-31 [PMID:22579628] Bloomer RH,Juenger TE,Symonds VV Natural variation in GL1 and its effects on trichome density in Arabidopsis thaliana. Mol. Ecol., 2012. 21(14): p. 3501-15 [PMID:22625421] Yan A,Pan J,An L,Gan Y,Feng H The responses of trichome mutants to enhanced ultraviolet-B radiation in Arabidopsis thaliana. J. Photochem. Photobiol. B, Biol., 2012. 113: p. 29-35 [PMID:22647943] Buschhaus C,Jetter R Composition and physiological function of the wax layers coating Arabidopsis leaves: β-amyrin negatively affects the intracuticular water barrier. Plant Physiol., 2012. 160(2): p. 1120-9 [PMID:22885935] Li F,Zou Z,Yong HY,Kitashiba H,Nishio T Nucleotide sequence variation of GLABRA1 contributing to phenotypic variation of leaf hairiness in Brassicaceae vegetables. Theor. Appl. Genet., 2013. 126(5): p. 1227-36 [PMID:23370467] Zhou Z, et al. Zinc Finger Protein 6 (ZFP6) regulates trichome initiation by integrating gibberellin and cytokinin signaling in Arabidopsis thaliana. New Phytol., 2013. 198(3): p. 699-708 [PMID:23506479] Qi T,Song S,Xie D Modified bimolecular fluorescence complementation assay to study the inhibition of transcription complex formation by JAZ proteins. Methods Mol. Biol., 2013. 1011: p. 187-97 [PMID:23615997] Wang G,Zhao GH,Jia YH,Du XM Identification and characterization of cotton genes involved in fuzz-fiber development. J Integr Plant Biol, 2013. 55(7): p. 619-30 [PMID:23710824] Pesch M,Schulthei Mutual control of intracellular localisation of the patterning proteins AtMYC1, GL1 and TRY/CPC in Arabidopsis. Development, 2013. 140(16): p. 3456-67 [PMID:23900543] Qi T, et al. Arabidopsis DELLA and JAZ proteins bind the WD-repeat/bHLH/MYB complex to modulate gibberellin and jasmonate signaling synergy. Plant Cell, 2014. 26(3): p. 1118-33 [PMID:24659329] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Liang G,He H,Li Y,Ai Q,Yu D MYB82 functions in regulation of trichome development in Arabidopsis. J. Exp. Bot., 2014. 65(12): p. 3215-23 [PMID:24803498] Sun L, et al. GLABROUS INFLORESCENCE STEMS3 (GIS3) regulates trichome initiation and development in Arabidopsis. New Phytol., 2015. 206(1): p. 220-30 [PMID:25640859] Yu D, et al. RPN1a, a subunit of the 26S proteasome, controls trichome development in Arabidopsis. Plant Physiol. Biochem., 2015. 88: p. 82-8 [PMID:25676129] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Pesch M, et al. TRANSPARENT TESTA GLABRA1 and GLABRA1 Compete for Binding to GLABRA3 in Arabidopsis. Plant Physiol., 2015. 168(2): p. 584-97 [PMID:25926482] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Dai X, et al. A single amino acid substitution in the R3 domain of GLABRA1 leads to inhibition of trichome formation in Arabidopsis without affecting its interaction with GLABRA3. Plant Cell Environ., 2016. 39(4): p. 897-907 [PMID:26667588] Zheng K, et al. Ectopic expression of R3 MYB transcription factor gene OsTCL1 in Arabidopsis, but not rice, affects trichome and root hair formation. Sci Rep, 2016. 6: p. 19254 [PMID:26758286] Li Y, et al. Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis. Sci Rep, 2016. 6: p. 30514 [PMID:27465838] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Busta L,Hegebarth D,Kroc E,Jetter R Changes in cuticular wax coverage and composition on developing Arabidopsis leaves are influenced by wax biosynthesis gene expression levels and trichome density. Planta, 2017. 245(2): p. 297-311 [PMID:27730411] Maxwell DJ,Partridge JC,Roberts NW,Boonham N,Foster GD The effects of surface structure mutations in Arabidopsis thaliana on the polarization of reflections from virus-infected leaves. PLoS ONE, 2017. 12(3): p. e0174014 [PMID:28346494] García-Cano E,Hak H,Magori S,Lazarowitz SG,Citovsky V The Agrobacterium F-Box Protein Effector VirF Destabilizes the Arabidopsis GLABROUS1 Enhancer/Binding Protein-Like Transcription Factor VFP4, a Transcriptional Activator of Defense Response Genes. Mol. Plant Microbe Interact., 2018. 31(5): p. 576-586 [PMID:29264953] Kim SY,Hyoung S,So WM,Shin JS The novel transcription factor TRP interacts with ZFP5, a trichome initiation-related transcription factor, and negatively regulates trichome initiation through gibberellic acid signaling. Plant Mol. Biol., 2018. 96(3): p. 315-326 [PMID:29335898] Larkin JC,Oppenheimer DG,Marks MD The GL1 gene and the trichome developmental pathway in Arabidopsis thaliana. Results Probl Cell Differ, 1994. 20: p. 259-75 [PMID:8036319] Esch JJ,Oppenheimer DG,Marks MD Characterization of a weak allele of the GL1 gene of Arabidopsis thaliana. Plant Mol. Biol., 1994. 24(1): p. 203-7 [PMID:8111017] Szymanski DB,Jilk RA,Pollock SM,Marks MD Control of GL2 expression in Arabidopsis leaves and trichomes. Development, 1998. 125(7): p. 1161-71 [PMID:9477315] Schnittger A,J Tissue layer and organ specificity of trichome formation are regulated by GLABRA1 and TRIPTYCHON in Arabidopsis. Development, 1998. 125(12): p. 2283-9 [PMID:9584127] Szymanski DB,Klis DA,Larkin JC,Marks MD cot1: a regulator of Arabidopsis trichome initiation. Genetics, 1998. 149(2): p. 565-77 [PMID:9611174] Perazza D,Vachon G,Herzog M Gibberellins promote trichome formation by Up-regulating GLABROUS1 in arabidopsis Plant Physiol., 1998. 117(2): p. 375-83 [PMID:9625690] Shikazono N,Yokota Y,Tanaka A,Watanabe H,Tano S Molecular analysis of carbon ion-induced mutations in Arabidopsis thaliana. Genes Genet. Syst., 1998. 73(3): p. 173-9 [PMID:9794081] Szymanski DB,Marks MD GLABROUS1 overexpression and TRIPTYCHON alter the cell cycle and trichome cell fate in Arabidopsis. Plant Cell, 1998. 10(12): p. 2047-62 [PMID:9836744]