PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013898209.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family G2-like
Protein Properties Length: 545aa    MW: 54386.3 Da    PI: 5.8181
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013898209.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.5e-31177231155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k rlrWtpeLH++Fv+ v+qLGG++kAtPk il++m+v+gLt++h+kSHLQkYRl
  XP_013898209.1 177 KSRLRWTPELHASFVRSVAQLGGPDKATPKGILKAMGVDGLTIYHIKSHLQKYRL 231
                     68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.109174234IPR017930Myb domain
SuperFamilySSF466891.15E-16176232IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-29176232IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23177232IPR006447Myb domain, plants
PfamPF002491.6E-7179230IPR001005SANT/Myb domain
PfamPF143791.1E-14385426IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MDNGLNDAEL GAWLEWLPQD DFHSTLEPAA GNGDAAQHQG AQMAVQPPSV GHQQQQQQHQ  60
QQGQGSGPSP QPAQAKTFQM VAMGAMDPLQ AQAYALQYPV QHQAGAFDQL LTAMPLAGHS  120
MASSGTQQQV AMGMAGPQQV APALYMPSGY SLQGAPSDAS GAAAAAAAAA AGMGGNKSRL  180
RWTPELHASF VRSVAQLGGP DKATPKGILK AMGVDGLTIY HIKSHLQKYR LNARVPGGGG  240
SAAAGSVDGA SDGAGAAGES WEAASAAGGD SPHSTGPGCG APPTALGMPL AAAAPAAGGQ  300
AGAAASSALA SAEQLLQQQR QVLPPVAQQQ QQQQHQQQIQ PPPRPPSAGP STSAAAPTSS  360
AAAAGAAAVD AATAEQAASV TRRDLEDALA LQMDLQKKLH EQLESQRQLQ LSLEAHGRYI  420
ASLMEQEGLG HRLQDIAGIT APGPGTPAAP AAAAGAAFGG CSGGGGERQE VEAAAGAGVG  480
GGGAPRLPVQ QQQQQQQQQQ QQQLLMREPE LGDLLGGLPL HAPSGFLPAA AGGGRLGAGV  540
GGGGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-21177230154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-21177230154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-21177230154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-21177230154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00628PBMTransfer from PK10342.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013898209.10.0hypothetical protein MNEG_8773
TrEMBLA0A0D2M7590.0A0A0D2M759_9CHLO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.13e-24G2-like family protein
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]