PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.001G205800.1 | ||||||||
Common Name | B456_001G205800, LOC105801407 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 180aa MW: 20698.1 Da PI: 6.6038 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48.7 | 1.6e-15 | 82 | 135 | 5 | 58 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 +++rr+++NRe+ArrsR RK+ ++eL v L +eN++L+++l++ ++ ++ Gorai.001G205800.1 82 RKQRRMISNRESARRSRMRKQRHLDELWAQVVWLRNENHQLIDKLNHVSESHDR 135 689*******************************************99887665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.9E-15 | 78 | 142 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.346 | 80 | 143 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.63E-13 | 82 | 132 | No hit | No description |
Pfam | PF00170 | 1.9E-13 | 82 | 140 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.1E-12 | 82 | 154 | No hit | No description |
CDD | cd14702 | 3.54E-19 | 83 | 134 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 85 | 100 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MQPSEVSGIQ YLVPSNPSPY SPHFSMNQSN KPALDSNQFL NPLYNFYIPP QIHDISPHSS 60 CISSNSTSDE ADEQQLSLII ERKQRRMISN RESARRSRMR KQRHLDELWA QVVWLRNENH 120 QLIDKLNHVS ESHDRVLQEN TQLKEEASEL RQMLFGMRLG HPNSTSVNLD DVALEHGLS* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 94 | 101 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00647 | PBM | Transfer from LOC_Os02g49560 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012488166.1 | 1e-129 | PREDICTED: basic leucine zipper 43-like | ||||
Refseq | XP_016682285.1 | 1e-129 | PREDICTED: basic leucine zipper 43-like | ||||
Refseq | XP_016746019.1 | 1e-129 | PREDICTED: basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 8e-40 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A0D2PUP2 | 1e-128 | A0A0D2PUP2_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8IW19 | 1e-128 | A0A1U8IW19_GOSHI; basic leucine zipper 43-like | ||||
TrEMBL | A0A2P5RI78 | 1e-128 | A0A2P5RI78_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.001G205800.1 | 1e-129 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3112 | 26 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 4e-44 | basic leucine-zipper 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.001G205800.1 |
Entrez Gene | 105801407 |
Publications ? help Back to Top | |||
---|---|---|---|
|