PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.001G107900.3 | ||||||||
Common Name | B456_001G107900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 185aa MW: 20978.2 Da PI: 4.6868 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.1 | 3e-16 | 2 | 43 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T+ E+ l +++++++G++ W++Iar+++ gRt++++k++w++++ Gorai.001G107900.3 2 TPHEERLVLELHAKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43 9*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.734 | 1 | 47 | IPR017930 | Myb domain |
CDD | cd00167 | 1.93E-12 | 1 | 43 | No hit | No description |
SMART | SM00717 | 1.5E-11 | 1 | 45 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-14 | 2 | 42 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.4E-20 | 2 | 44 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.62E-12 | 2 | 47 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MTPHEERLVL ELHAKWGNRW SRIARKLPGR TDNEIKNYWR THMRKTAQEK KRAIPISPSS 60 SSSNCHSSSS TVTTVDSLPS SGTGNIVSFY DTGGLDMAGK KNSPEFEDGN GYSMDDIWKD 120 IDMPEEDTII KPLPDNYSQQ GCNFSWEYCW DSLWKMDDEE ESKMFFPPNQ LVSCFDFGTE 180 SVTG* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00600 | PBM | Transfer from AT5G59780 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012474433.1 | 1e-136 | PREDICTED: transcription factor MYB48-like isoform X2 | ||||
Swissprot | Q9LX82 | 1e-45 | MYB48_ARATH; Transcription factor MYB48 | ||||
TrEMBL | A0A0D2LWQ9 | 1e-135 | A0A0D2LWQ9_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A0D2N7I9 | 1e-135 | A0A0D2N7I9_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.001G107900.1 | 1e-135 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46130.2 | 6e-46 | myb domain protein 48 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.001G107900.3 |
Publications ? help Back to Top | |||
---|---|---|---|
|