PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G46130.2

Common Name

ATMYB48, ATMYB48-1, ATMYB48-2, ATMYB48-3, MYB48

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 192aa MW: 22086.3 Da PI: 7.9832

Description

myb domain protein 48

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G46130.2	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.9	8.7e-17	2	43	5	48
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++ AT3G46130.2 2 TPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 43 9***************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.772	1	47	IPR017930	Myb domain
SMART	SM00717	3.1E-12	1	45	IPR001005	SANT/Myb domain
CDD	cd00167	2.17E-12	1	43	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.4E-20	2	44	IPR009057	Homeodomain-like
Pfam	PF00249	4.3E-15	2	42	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.23E-13	2	48	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009751	Biological Process	response to salicylic acid
GO:0030154	Biological Process	cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009025	anatomy	vascular leaf
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 192 aa Download sequence Send to blast
MTPQEERLVL ELHAKWGNRW SKIARKLPGR TDNEIKNYWR THMRKKAQEK KRPVSPTSSF 60 SNCSSSSVTT TTTNTQDTSC HSRKSSGEVS FYDTGGSRST REMNQENEDV YSLDDIWREI 120 DHSAVNIIKP VKDIYSEQSH CLSYPNLASP SWESSLDSIW NMDADKSKIS SYFANDQFPF 180 CFQHSRSPWS SG

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.1475	0.0	leaf

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	252534_at	0.0
Expression Atlas	AT3G46130	-
AtGenExpress	AT3G46130	-
ATTED-II	AT3G46130	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269\|PubMed:16531467}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a putative transcription factor (MYB48) that functions to regulate flavonol biosynthesis primarily in cotyledons.
UniProt	Transcription factor. {ECO:0000305}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G46130.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salicylic acid (SA). {ECO:0000269\|PubMed:16463103}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G46130

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF272733	0.0	AF272733.1 Arabidopsis thaliana putative transcription factor (MYB48) mRNA, complete cds.
GenBank	AK176475	0.0	AK176475.1 Arabidopsis thaliana mRNA for Myb DNA binding protein -like, complete cds, clone: RAFL24-27-H12.
GenBank	AY519594	0.0	AY519594.1 Arabidopsis thaliana MYB transcription factor (At3g46130) mRNA, complete cds.
GenBank	DQ075255	0.0	DQ075255.1 Arabidopsis thaliana MYB transcription factor MYB48-1 (At3g46130) mRNA, complete cds, alternatively spliced.
GenBank	DQ075256	0.0	DQ075256.1 Arabidopsis thaliana MYB transcription factor MYB48-2 (At3g46130) mRNA, complete cds, alternatively spliced.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001030816.1	1e-142	myb domain protein 48
Refseq	NP_001190018.1	1e-141	myb domain protein 48
Swissprot	Q9LX82	1e-142	MYB48_ARATH; Transcription factor MYB48
TrEMBL	A0A178V991	1e-140	A0A178V991_ARATH; MYB48
TrEMBL	F4J7Y0	1e-140	F4J7Y0_ARATH; Myb domain protein 48
STRING	AT3G46130.1	1e-140	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT3G46130.2
Entrez Gene	823756
iHOP	AT3G46130
wikigenes	AT3G46130

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Rashotte AM,Carson SD,To JP,Kieber JJ Expression profiling of cytokinin action in Arabidopsis. Plant Physiol., 2003. 132(4): p. 1998-2011 [PMID:12913156] Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light. Plant J., 2003. 36(2): p. 203-14 [PMID:14535885] Stanley Kim H, et al. Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome. Plant J., 2005. 41(2): p. 212-20 [PMID:15634198] Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl. Plant Physiol., 2005. 138(2): p. 803-18 [PMID:15923329] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Li J, et al. A subgroup of MYB transcription factor genes undergoes highly conserved alternative splicing in Arabidopsis and rice. J. Exp. Bot., 2006. 57(6): p. 1263-73 [PMID:16531467] Bi YM,Wang RL,Zhu T,Rothstein SJ Global transcription profiling reveals differential responses to chronic nitrogen stress and putative nitrogen regulatory components in Arabidopsis. BMC Genomics, 2007. 8: p. 281 [PMID:17705847] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Imran QM, et al. Transcriptome profile of NO-induced Arabidopsis transcription factor genes suggests their putative regulatory role in multiple biological processes. Sci Rep, 2018. 8(1): p. 771 [PMID:29335449]