PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G59780.3

Common Name

ATMYB59, ATMYB59-1, ATMYB59-2, ATMYB59-3, MTH12.19, MYB59

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 235aa MW: 27236.7 Da PI: 8.6904

Description

myb domain protein 59

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G59780.3	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.4	1.5e-17	10	57	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed llv+ v+++G ++W+ +a+ g++Rt+k+c++rw +yl AT5G59780.3 10 KGPWTEQEDILLVNFVHLFGDRRWDFVAKVSGLNRTGKSCRLRWVNYL 57 79********************************************97 PP
2	Myb_DNA-binding	56.4	7e-18	63	108	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++ AT5G59780.3 63 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 108 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.98	5	57	IPR017930	Myb domain
SuperFamily	SSF46689	8.27E-30	8	104	IPR009057	Homeodomain-like
SMART	SM00717	1.8E-15	9	59	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-16	10	57	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-20	11	64	IPR009057	Homeodomain-like
CDD	cd00167	6.26E-11	12	57	No hit	No description
PROSITE profile	PS51294	27.814	58	112	IPR017930	Myb domain
SMART	SM00717	2.2E-17	62	110	IPR001005	SANT/Myb domain
Pfam	PF00249	2.5E-16	63	107	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.6E-24	65	111	IPR009057	Homeodomain-like
CDD	cd00167	3.13E-12	65	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009723	Biological Process	response to ethylene
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010200	Biological Process	response to chitin
GO:0030154	Biological Process	cell differentiation
GO:0046686	Biological Process	response to cadmium ion
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000003	anatomy	whole plant
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007131	developmental stage	seedling development stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 235 aa Download sequence Send to blast
MKLVQEEYRK GPWTEQEDIL LVNFVHLFGD RRWDFVAKVS GLNRTGKSCR LRWVNYLHPG 60 LKRGKMTPQE ERLVLELHAK WGNRWSKIAR KLPGRTDNEI KNYWRTHMRK KAQEKKRPMS 120 PTSSSSNCCS SSMTTTTSQD TGGSNGKMNQ ECEDGYYSMD DIWREIDQSG ANVIKPVKDN 180 YYSEQSCYLN FPPLASPTWE SSLESIWNMD ADESKMSSFA IDQFPLSFEH GSGRL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h88_C	3e-28	2	112	50	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	3e-28	2	112	50	159	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.22428	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145362066	0.0
Genevisible	247696_at	0.0
Expression Atlas	AT5G59780	-
AtGenExpress	AT5G59780	-
ATTED-II	AT5G59780	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269\|PubMed:16531467}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a putative transcription factor (MYB59).
UniProt	Transcription factor. {ECO:0000305}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00600	PBM	24477691	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G59780.3

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	auxin, ethylene, gibberellin, jasmonic acid, salicylic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G59780

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519641	0.0	AY519641.1 Arabidopsis thaliana MYB transcription factor (At5g59780) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_200786.1	1e-178	myb domain protein 59
Swissprot	Q4JL84	1e-179	MYB59_ARATH; Transcription factor MYB59
TrEMBL	D7MSI4	1e-172	D7MSI4_ARALL; Uncharacterized protein
STRING	AT5G59780.3	1e-178	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2502	27	74
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT5G59780.3
Entrez Gene	836099
iHOP	AT5G59780
wikigenes	AT5G59780

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Nikiforova V, et al. Transcriptome analysis of sulfur depletion in Arabidopsis thaliana: interlacing of biosynthetic pathways provides response specificity. Plant J., 2003. 33(4): p. 633-50 [PMID:12609038] Jiao Y, et al. A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development. Plant Physiol., 2003. 133(4): p. 1480-93 [PMID:14605227] Contento AL,Kim SJ,Bassham DC Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation. Plant Physiol., 2004. 135(4): p. 2330-47 [PMID:15310832] Stanley Kim H, et al. Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome. Plant J., 2005. 41(2): p. 212-20 [PMID:15634198] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] He XJ, et al. AtNAC2, a transcription factor downstream of ethylene and auxin signaling pathways, is involved in salt stress response and lateral root development. Plant J., 2005. 44(6): p. 903-16 [PMID:16359384] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Li J, et al. A subgroup of MYB transcription factor genes undergoes highly conserved alternative splicing in Arabidopsis and rice. J. Exp. Bot., 2006. 57(6): p. 1263-73 [PMID:16531467] Cao D,Cheng H,Wu W,Soo HM,Peng J Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] Lee J, et al. Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development. Plant Cell, 2007. 19(3): p. 731-49 [PMID:17337630] Libault M,Wan J,Czechowski T,Udvardi M,Stacey G Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Agudelo-Romero P, et al. Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus. Virol. J., 2008. 5: p. 92 [PMID:18684336] Mu RL, et al. An R2R3-type transcription factor gene AtMYB59 regulates root growth and cell cycle progression in Arabidopsis. Cell Res., 2009. 19(11): p. 1291-304 [PMID:19581938] Cominelli E,Tonelli C A new role for plant R2R3-MYB transcription factors in cell cycle regulation. Cell Res., 2009. 19(11): p. 1231-2 [PMID:19881525] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376] Romero I, et al. More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis thaliana. Plant J., 1998. 14(3): p. 273-84 [PMID:9628022] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]