PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A05G1167 | ||||||||
Common Name | MYB3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 193aa MW: 22534.4 Da PI: 10.0001 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.3 | 4.2e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l+++++ +G ++WktI++ g++R++k+c++rw +yl Gh_A05G1167 14 KGAWTAEEDRKLAEVITVHGAKRWKTIPSIAGLNRCGKSCRLRWMNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.9 | 3.7e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Gh_A05G1167 67 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 112 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.448 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.37E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.7E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.1E-24 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.64E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 20.665 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-14 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-25 | 69 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.58E-10 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0090378 | Biological Process | seed trichome elongation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MEQNLSLKRF DVNKGAWTAE EDRKLAEVIT VHGAKRWKTI PSIAGLNRCG KSCRLRWMNY 60 LRPNIKRGNI SDQEEDLILR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNS HLSKKVNQKE 120 KHRGASARQG CKFAQQRLVE NAKEQVREEN TSTGFGESNI SFDVDDFFDF SNVDTRNFEW 180 VNRFLEVDDG FKF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-29 | 11 | 117 | 4 | 109 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.8087 | 0.0 | boll |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF034131 | 0.0 | AF034131.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016749598.1 | 1e-141 | PREDICTED: transcription factor MYB114-like | ||||
Refseq | XP_017605145.1 | 1e-141 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | Q9FJA2 | 2e-51 | TT2_ARATH; Transcription factor TT2 | ||||
TrEMBL | A0A0B0NG51 | 1e-140 | A0A0B0NG51_GOSAR; Transcription factor TT2-like protein | ||||
TrEMBL | A0A2P5W9U7 | 1e-140 | A0A2P5W9U7_GOSBA; Uncharacterized protein | ||||
TrEMBL | O49018 | 1e-140 | O49018_GOSHI; MYB-like DNA-binding domain protein | ||||
STRING | Gorai.009G146500.1 | 1e-127 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35550.1 | 1e-53 | MYB family protein |