PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G35550.1

Common Name

ATMYB123, ATTT2, MOK9.18, MYB123, TT2

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 258aa MW: 29611.4 Da PI: 8.9031

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G35550.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.8	4.6e-17	16	63	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT Ed++l d+++ +G g W+t ++ g++R++k+c++rw +yl AT5G35550.1 16 RGAWTDHEDKILRDYITTHGEGKWSTLPNQAGLKRCGKSCRLRWKNYL 63 89********************************************97 PP
2	Myb_DNA-binding	52.4	1.2e-16	69	113	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ AT5G35550.1 69 RGNISSDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNHWNSN 113 78999***************.*****.*********976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.289	11	63	IPR017930	Myb domain
SuperFamily	SSF46689	7.7E-28	14	110	IPR009057	Homeodomain-like
SMART	SM00717	4.0E-12	15	65	IPR001005	SANT/Myb domain
Pfam	PF00249	1.8E-13	16	63	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.3E-22	17	70	IPR009057	Homeodomain-like
CDD	cd00167	1.00E-8	18	63	No hit	No description
PROSITE profile	PS51294	24.564	64	118	IPR017930	Myb domain
SMART	SM00717	2.1E-15	68	116	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-14	69	113	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.3E-23	71	118	IPR009057	Homeodomain-like
CDD	cd00167	1.59E-10	73	114	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0006633	Biological Process	fatty acid biosynthetic process
GO:0006970	Biological Process	response to osmotic stress
GO:0009813	Biological Process	flavonoid biosynthetic process
GO:0010023	Biological Process	proanthocyanidin biosynthetic process
GO:0090379	Biological Process	secondary cell wall biogenesis involved in seed trichome differentiation
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515	Molecular Function	protein binding
GO:0005524	Molecular Function	ATP binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 258 aa Download sequence Send to blast
MGKRATTSVR REELNRGAWT DHEDKILRDY ITTHGEGKWS TLPNQAGLKR CGKSCRLRWK 60 NYLRPGIKRG NISSDEEELI IRLHNLLGNR WSLIAGRLPG RTDNEIKNHW NSNLRKRLPK 120 TQTKQPKRIK HSTNNENNVC VIRTKAIRCS KTLLFSDLSL QKKSSTSPLP LKEQEMDQGG 180 SSLMGDLEFD FDRIHSEFHF PDLMDFDGLD CGNVTSLVSS NEILGELVPA QGNLDLNRPF 240 TSCHHRGDDE DWLRDFTC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	3e-26	13	118	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	249704_at	0.0
Expression Atlas	AT5G35550	-
AtGenExpress	AT5G35550	-
ATTED-II	AT5G35550	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis.
Uniprot	TISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems.

Functional Description ? help Back to Top
Source	Description
TAIR	TT2 encodes a R2R3 MYB domain putative transcription factor that acts as a key determinant in the proanthocyanidin accumulation of developing seed. It is thought that a ternary complex composed of TT2, TT8 and TTG1 is necessary for correct expression of BAN in seed endothelium.
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269\|PubMed:15361138}.

Function -- GeneRIF ? help Back to Top
AtMYB5 and TT2, as partially redundant in regulating this outer seed coat developmental process with MYB5 having the major role. MYB5 and TT2 are shown to be expressed in this outer seed coat domain. [PMID: 18992236] TT1 (TRANSPARENT TESTA1) interacts with the MYB transcription factor TT2. [PMID: 21477081] Loss of TT2 function results in more sufficient fatty acid synthesis. [PMID: 22879396] directly bound to the regulatory region of FUSCA3, and mediates the expression of numerous genes in the fatty acid biosynthesis pathway [PMID: 24397827]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G35550.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G71030 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G61720(A), AT1G79840(A), AT2G37260(A), AT3G59030(A), AT4G09820(A), AT4G22880(A), AT5G42800(A)

Interaction -- BIND ? help Back to Top
Source	Intact With	Description
BIND	AT1G63650	EGL3 interacts with TT2.

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G35550, AT1G34790, AT1G53230, AT1G63650
IntAct	Search Q9FJA2

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G35550

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF371981	0.0	AF371981.2 Arabidopsis thaliana putative transcription factor MYB123 (MYB123) mRNA, complete cds.
GenBank	AY519630	0.0	AY519630.1 Arabidopsis thaliana MYB transcription factor (At5g35550) mRNA, complete cds.
GenBank	DQ447000	0.0	DQ447000.1 Arabidopsis thaliana clone pENTR221-At5g35550 myb family transcription factor (At5g35550) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_198405.1	0.0	Duplicated homeodomain-like superfamily protein
Swissprot	Q9FJA2	0.0	TT2_ARATH; Transcription factor TT2
TrEMBL	A0A178UCY6	0.0	A0A178UCY6_ARATH; TT2
STRING	AT5G35550.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT5G35550.1
Entrez Gene	833520
iHOP	AT5G35550
wikigenes	AT5G35550

Publications ? help Back to Top
Nesi N, et al. The TT8 gene encodes a basic helix-loop-helix domain protein required for expression of DFR and BAN genes in Arabidopsis siliques. Plant Cell, 2000. 12(10): p. 1863-78 [PMID:11041882] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Nesi N,Jond C,Debeaujon I,Caboche M,Lepiniec L The Arabidopsis TT2 gene encodes an R2R3 MYB domain protein that acts as a key determinant for proanthocyanidin accumulation in developing seed. Plant Cell, 2001. 13(9): p. 2099-114 [PMID:11549766] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Abrahams S, et al. The Arabidopsis TDS4 gene encodes leucoanthocyanidin dioxygenase (LDOX) and is essential for proanthocyanidin synthesis and vacuole development. Plant J., 2003. 35(5): p. 624-36 [PMID:12940955] Baudry A, et al. TT2, TT8, and TTG1 synergistically specify the expression of BANYULS and proanthocyanidin biosynthesis in Arabidopsis thaliana. Plant J., 2004. 39(3): p. 366-80 [PMID:15255866] Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. Plant J., 2004. 40(1): p. 22-34 [PMID:15361138] Sharma SB,Dixon RA Metabolic engineering of proanthocyanidins by ectopic expression of transcription factors in Arabidopsis thaliana. Plant J., 2005. 44(1): p. 62-75 [PMID:16167896] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Baudry A,Caboche M,Lepiniec L TT8 controls its own expression in a feedback regulation involving TTG1 and homologous MYB and bHLH factors, allowing a strong and cell-specific accumulation of flavonoids in Arabidopsis thaliana. Plant J., 2006. 46(5): p. 768-79 [PMID:16709193] Wei YL, et al. Molecular cloning of Brassica napus TRANSPARENT TESTA 2 gene family encoding potential MYB regulatory proteins of proanthocyanidin biosynthesis. Mol. Biol. Rep., 2007. 34(2): p. 105-20 [PMID:17115250] Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] Bogs J,Jaffé FW,Takos AM,Walker AR,Robinson SP The grapevine transcription factor VvMYBPA1 regulates proanthocyanidin synthesis during fruit development. Plant Physiol., 2007. 143(3): p. 1347-61 [PMID:17208963] Berger B, et al. A simplified method for the analysis of transcription factor-promoter interactions that allows high-throughput data generation. Plant J., 2007. 50(5): p. 911-6 [PMID:17425717] Skirycz A, et al. Transcription factor AtDOF4;2 affects phenylpropanoid metabolism in Arabidopsis thaliana. New Phytol., 2007. 175(3): p. 425-38 [PMID:17635218] Ishida T, et al. Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation. Plant Cell, 2007. 19(8): p. 2531-43 [PMID:17766401] Yoshida K, et al. Functional differentiation of Lotus japonicus TT2s, R2R3-MYB transcription factors comprising a multigene family. Plant Cell Physiol., 2008. 49(2): p. 157-69 [PMID:18202001] Dubos C, et al. MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana. Plant J., 2008. 55(6): p. 940-53 [PMID:18532978] Pang Y,Peel GJ,Sharma SB,Tang Y,Dixon RA A transcript profiling approach reveals an epicatechin-specific glucosyltransferase expressed in the seed coat of Medicago truncatula. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(37): p. 14210-5 [PMID:18772380] Gonzalez A,Mendenhall J,Huo Y,Lloyd A TTG1 complex MYBs, MYB5 and TT2, control outer seed coat differentiation. Dev. Biol., 2009. 325(2): p. 412-21 [PMID:18992236] Buer CS,Djordjevic MA Architectural phenotypes in the transparent testa mutants of Arabidopsis thaliana. J. Exp. Bot., 2009. 60(3): p. 751-63 [PMID:19129166] Nesi N, et al. The promoter of the Arabidopsis thaliana BAN gene is active in proanthocyanidin-accumulating cells of the Brassica napus seed coat. Plant Cell Rep., 2009. 28(4): p. 601-17 [PMID:19153740] Mellway RD,Tran LT,Prouse MB,Campbell MM,Constabel CP The wound-, pathogen-, and ultraviolet B-responsive MYB134 gene encodes an R2R3 MYB transcription factor that regulates proanthocyanidin synthesis in poplar. Plant Physiol., 2009. 150(2): p. 924-41 [PMID:19395405] Arsovski AA,Villota MM,Rowland O,Subramaniam R,Western TL MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana. J. Exp. Bot., 2009. 60(9): p. 2601-12 [PMID:19401413] Zhao J,Dixon RA MATE transporters facilitate vacuolar uptake of epicatechin 3'-O-glucoside for proanthocyanidin biosynthesis in Medicago truncatula and Arabidopsis. Plant Cell, 2009. 21(8): p. 2323-40 [PMID:19684242] Brueggemann J,Weisshaar B,Sagasser M A WD40-repeat gene from Malus x domestica is a functional homologue of Arabidopsis thaliana TRANSPARENT TESTA GLABRA1. Plant Cell Rep., 2010. 29(3): p. 285-94 [PMID:20107808] Appelhagen I, et al. TRANSPARENT TESTA1 interacts with R2R3-MYB factors and affects early and late steps of flavonoid biosynthesis in the endothelium of Arabidopsis thaliana seeds. Plant J., 2011. 67(3): p. 406-19 [PMID:21477081] Th A new system for fast and quantitative analysis of heterologous gene expression in plants. New Phytol., 2012. 193(2): p. 504-12 [PMID:22023451] Jia L, et al. Proanthocyanidins inhibit seed germination by maintaining a high level of abscisic acid in Arabidopsis thaliana. J Integr Plant Biol, 2012. 54(9): p. 663-73 [PMID:22765383] Chen M, et al. The effect of transparent TESTA2 on seed fatty acid biosynthesis and tolerance to environmental stresses during young seedling establishment in Arabidopsis. Plant Physiol., 2012. 160(2): p. 1023-36 [PMID:22879396] Schaart JG, et al. Identification and characterization of MYB-bHLH-WD40 regulatory complexes controlling proanthocyanidin biosynthesis in strawberry (Fragaria New Phytol., 2013. 197(2): p. 454-67 [PMID:23157553] Heppel SC, et al. Identification of key amino acids for the evolution of promoter target specificity of anthocyanin and proanthocyanidin regulating MYB factors. Plant Mol. Biol., 2013. 82(4-5): p. 457-71 [PMID:23689818] Li S,Zachgo S TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana. Plant J., 2013. 76(6): p. 901-13 [PMID:24118612] Wang Z, et al. TRANSPARENT TESTA2 regulates embryonic fatty acid biosynthesis by targeting FUSCA3 during the early developmental stage of Arabidopsis seeds. Plant J., 2014. 77(5): p. 757-69 [PMID:24397827] Coego A, et al. The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J., 2014. 77(6): p. 944-53 [PMID:24456507] Liu C,Jun JH,Dixon RA MYB5 and MYB14 Play Pivotal Roles in Seed Coat Polymer Biosynthesis in Medicago truncatula. Plant Physiol., 2014. 165(4): p. 1424-1439 [PMID:24948832] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Zhu Z, et al. Characterization of the cis elements in the proximal promoter regions of the anthocyanin pathway genes reveals a common regulatory logic that governs pathway regulation. J. Exp. Bot., 2015. 66(13): p. 3775-89 [PMID:25911741] Liu Y,Shi Z,Maximova SN,Payne MJ,Guiltinan MJ Tc-MYBPA an Arabidopsis TT2-like transcription factor and functions in the regulation of proanthocyanidin synthesis in Theobroma cacao. BMC Plant Biol., 2015. 15: p. 160 [PMID:26109181] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Li Y, et al. Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis. Sci Rep, 2016. 6: p. 30514 [PMID:27465838] Li C,Zhang B,Chen B,Ji L,Yu H Site-specific phosphorylation of TRANSPARENT TESTA GLABRA1 mediates carbon partitioning in Arabidopsis seeds. Nat Commun, 2018. 9(1): p. 571 [PMID:29422671]