PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462927065 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 145aa MW: 16291.7 Da PI: 10.8526 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 55.9 | 5.9e-18 | 77 | 111 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++C ++kTp+WR gp g+ktLCnaCG+++++ +l 462927065 77 CTHCMSSKTPQWRTGPMGPKTLCNACGVRFKSGRL 111 *******************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 11.451 | 71 | 107 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.8E-17 | 71 | 125 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 1.85E-15 | 73 | 134 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.3E-14 | 75 | 109 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 4.90E-13 | 76 | 133 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 77 | 102 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 9.3E-16 | 77 | 111 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MDVHPPNAAA NSLGDLFPHQ AALVKPENRF TTISEKQWGQ GTNKKQEHGK RRDKKKIKKT 60 PNAIERELPP EPPTRVCTHC MSSKTPQWRT GPMGPKTLCN ACGVRFKSGR LLPEYRPANS 120 PTFVSHIHSN SHKKVLQLRQ GDGHM |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 50 | 58 | RRDKKKIKK |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00047 | PBM | Transfer from AT1G08000 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462927065 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004963249.1 | 2e-51 | GATA transcription factor 2 | ||||
TrEMBL | A0A0A9VSA1 | 1e-56 | A0A0A9VSA1_ARUDO; Uncharacterized protein | ||||
STRING | Pavir.Cb00086.1.p | 3e-51 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5962 | 36 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45050.1 | 5e-35 | GATA transcription factor 2 |