PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G45050.1

Common Name

GATA2, T14P1.14

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

GATA

Protein Properties

Length: 264aa MW: 28864 Da PI: 8.29

Description

GATA transcription factor 2

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G45050.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GATA	56.2	4.6e-18	181	215	1	35
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++C + kTp+WR gp g+ktLCnaCG+++++ +l AT2G45050.1 181 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 215 *******************************9885 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF016992	3.3E-96	2	264	IPR016679	Transcription factor, GATA, plant
SMART	SM00401	4.8E-15	175	225	IPR000679	Zinc finger, GATA-type
PROSITE profile	PS50114	11.227	179	211	IPR000679	Zinc finger, GATA-type
SuperFamily	SSF57716	2.71E-14	179	239	No hit	No description
Gene3D	G3DSA:3.30.50.10	1.6E-13	179	213	IPR013088	Zinc finger, NHR/GATA-type
CDD	cd00202	7.27E-14	180	227	No hit	No description
Pfam	PF00320	7.3E-16	181	215	IPR000679	Zinc finger, GATA-type
PROSITE pattern	PS00344	0	181	206	IPR000679	Zinc finger, GATA-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009416	Biological Process	response to light stimulus
GO:0030154	Biological Process	cell differentiation
GO:0045944	Biological Process	positive regulation of transcription from RNA polymerase II promoter
GO:0005634	Cellular Component	nucleus
GO:0005667	Cellular Component	transcription factor complex
GO:0000977	Molecular Function	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085	Molecular Function	RNA polymerase II transcription factor binding
GO:0001228	Molecular Function	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682	Molecular Function	chromatin binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0008270	Molecular Function	zinc ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009030	anatomy	carpel
PO:0009032	anatomy	petal
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 264 aa Download sequence Send to blast
MDVYGLSSPD LLRIDDLLDF SNEDIFSASS SGGSTAATSS SSFPPPQNPS FHHHHLPSSA 60 DHHSFLHDIC VPSDDAAHLE WLSQFVDDSF ADFPANPLGG TMTSVKTETS FPGKPRSKRS 120 RAPAPFAGTW SPMPLESEHQ QLHSAAKFKP KKEQSGGGGG GGGRHQSSSS ETTEGGGMRR 180 CTHCASEKTP QWRTGPLGPK TLCNACGVRF KSGRLVPEYR PASSPTFVLT QHSNSHRKVM 240 ELRRQKEVMR QPQQVQLHHH HHPF

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.216	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	266125_at	0.0
Expression Atlas	AT2G45050	-
AtGenExpress	AT2G45050	-
ATTED-II	AT2G45050	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in flowers and leaves, and to a lower extent in stems. {ECO:0000269\|PubMed:12139008}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the GATA factor family of zinc finger transcription factors.
UniProt	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269\|PubMed:12139008}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G45050.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G45050

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK317134	0.0	AK317134.1 Arabidopsis thaliana AT2G45050 mRNA, complete cds, clone: RAFL21-72-C19.
GenBank	BT000921	0.0	BT000921.1 Arabidopsis thaliana clone C105099 putative GATA-type zinc finger transcription factor (At2g45050) mRNA, complete cds.
GenBank	Y13649	0.0	Y13649.1 Arabidopsis thaliana mRNA for GATA transcription factor 2.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_182031.1	0.0	GATA transcription factor 2
Swissprot	O49741	0.0	GATA2_ARATH; GATA transcription factor 2
TrEMBL	A0A384L0T5	0.0	A0A384L0T5_ARATH; GATA transcription factor
TrEMBL	B9DGF3	0.0	B9DGF3_ARATH; GATA transcription factor
STRING	AT2G45050.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3203	26	66
Representative plant	OGRP68	17	287

Link Out ? help Back to Top
Phytozome	AT2G45050.1
Entrez Gene	819112
iHOP	AT2G45050
wikigenes	AT2G45050

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Teakle GR,Manfield IW,Graham JF,Gilmartin PM Arabidopsis thaliana GATA factors: organisation, expression and DNA-binding characteristics. Plant Mol. Biol., 2002. 50(1): p. 43-57 [PMID:12139008] Jeong MJ,Jeong MJ,Shih MC Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis. Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62 [PMID:12504119] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Goda H, et al. Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. Plant Physiol., 2004. 134(4): p. 1555-73 [PMID:15047898] Reyes JC,Muro-Pastor MI,Florencio FJ The GATA family of transcription factors in Arabidopsis and rice. Plant Physiol., 2004. 134(4): p. 1718-32 [PMID:15084732] Tepperman JM, et al. Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation. Plant J., 2004. 38(5): p. 725-39 [PMID:15144375] Nakamura A, et al. Arabidopsis Aux/IAA genes are involved in brassinosteroid-mediated growth responses in a manner dependent on organ type. Plant J., 2006. 45(2): p. 193-205 [PMID:16367964] Zhang L, et al. Conservation of noncoding microsatellites in plants: implication for gene regulation. BMC Genomics, 2006. 7: p. 323 [PMID:17187690] Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family. Plant Physiol., 2007. 143(2): p. 941-58 [PMID:17208962] Luo XM, et al. Integration of light- and brassinosteroid-signaling pathways by a GATA transcription factor in Arabidopsis. Dev. Cell, 2010. 19(6): p. 872-83 [PMID:21145502] Jiang K,Yung V,Chiba T,Feldman LJ Longitudinal patterning in roots: a GATA2-auxin interaction underlies and maintains the root transition domain. Planta, 2018. 247(4): p. 831-843 [PMID:29249045]