PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS657709.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 110aa MW: 12674.6 Da PI: 10.8542 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 40.2 | 7.9e-13 | 23 | 65 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +++eE+ l+ + G++ W+ Ia+ ++ gRt++++k++w++ EcS657709.10 23 GGFSEEEENLICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 65 569******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.344 | 1 | 16 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 7.5E-12 | 2 | 28 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.98E-21 | 3 | 71 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.253 | 17 | 71 | IPR017930 | Myb domain |
SMART | SM00717 | 5.8E-11 | 21 | 69 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-11 | 23 | 65 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.27E-8 | 25 | 67 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-18 | 29 | 68 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
LKRCGKSCRL RWLNYLRPNI KHGGFSEEEE NLICSLYISI GSRWSIIAAQ LPGRTDNDIK 60 NYWNTRLKKK LLGKQRKDPN ARRGSGSLKQ ELKRGISLGK SNTNSMDYSF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-19 | 3 | 71 | 40 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010061604.1 | 4e-73 | PREDICTED: transcription repressor MYB6 | ||||
Swissprot | Q9M2Y9 | 3e-48 | RAX3_ARATH; Transcription factor RAX3 | ||||
TrEMBL | A0A059BSG5 | 7e-72 | A0A059BSG5_EUCGR; Uncharacterized protein | ||||
STRING | XP_010061604.1 | 1e-72 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49690.1 | 4e-46 | myb domain protein 84 |
Publications ? help Back to Top | |||
---|---|---|---|
|