PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G49690.1 | ||||||||
Common Name | ATMYB84, MYB84, RAX3, T16K5.40 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 310aa MW: 35578.1 Da PI: 7.311 | ||||||||
Description | myb domain protein 84 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.1 | 1.1e-14 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l+ +++ G+g +W + ++++g++R++k+c++rw++yl AT3G49690.1 14 KGPWSPEEDAKLKSYIENSGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62 79*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 36.8 | 9.3e-12 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +++eE+ ++ + G++ W+ Ia+ ++ gRt++++k++w++ AT3G49690.1 69 GGFSEEEENIICSLYLTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111 569******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.058 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.65E-25 | 11 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-10 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-14 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-23 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.17E-7 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 20.442 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 1.5E-10 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-10 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-23 | 70 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.21E-7 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0009005 | anatomy | root | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 310 aa Download sequence Send to blast |
MGRAPCCDKA NVKKGPWSPE EDAKLKSYIE NSGTGGNWIA LPQKIGLKRC GKSCRLRWLN 60 YLRPNIKHGG FSEEEENIIC SLYLTIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLINK 120 QRKELQEACM EQQEMMVMMK RQHQQQQIQT SFMMRQDQTM FTWPLHHHNV QVPALFMNQT 180 NSFCDQEDVK PVLIKNMVKI EDQELEKTNP HHHQDSMTNA FDHLSFSQLL LDPNHNHLGS 240 GEGFSMNSIL SANTNSPLLN TSNDNQWFGN FQAETVNLFS GASTSTSADQ STISWEDISS 300 LVYSDSKQFF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-23 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145339299 | 0.0 | ||||
Genevisible | 252233_at | 0.0 | ||||
Expression Atlas | AT3G49690 | - | ||||
AtGenExpress | AT3G49690 | - | ||||
ATTED-II | AT3G49690 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in an adaxial ball-shaped set of cells in three to five cell layers around the L3 layer of the shoot apical meristem (SAM) in youg plantlets. In the inflorescence meristem, confined to the axils of flower primordia. {ECO:0000269|PubMed:16461581}. | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16461581}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | "Putative homolog of the Blind gene in tomato. Together with RAX1 and RAX3 belong to the class R2R3 MYB genes; encoded by the Myb-like transcription factor MYB84, regulates axillary meristem formation. " | |||||
UniProt | Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00089 | SELEX | 26531826 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G49690.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | salicylic acid |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
IntAct | Search Q9M2Y9 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G49690 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519597 | 0.0 | AY519597.1 Arabidopsis thaliana MYB transcription factor (At3g49690) mRNA, complete cds. | |||
GenBank | BT029224 | 0.0 | BT029224.1 Arabidopsis thaliana At3g49690 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_190538.1 | 0.0 | myb domain protein 84 | ||||
Swissprot | Q9M2Y9 | 0.0 | RAX3_ARATH; Transcription factor RAX3 | ||||
TrEMBL | A0A178VK29 | 0.0 | A0A178VK29_ARATH; RAX3 | ||||
STRING | AT3G49690.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2941 | 25 | 68 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G49690.1 |
Entrez Gene | 824131 |
iHOP | AT3G49690 |
wikigenes | AT3G49690 |