PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS511180.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 54aa MW: 6345.26 Da PI: 9.1949

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS511180.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	27.3	8.5e-09	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg WT+ Ed++lvd+++ +G g W+ +++ g EcS511180.10 14 RGIWTAGEDKILVDYIEAHGEGKWRDLPQRAG 45 788***********************999988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.4E-11	5	43	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.8E-8	8	45	IPR009057	Homeodomain-like
PROSITE profile	PS51294	9.201	9	54	IPR017930	Myb domain
Pfam	PF00249	3.7E-6	14	45	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 54 aa Download sequence Send to blast
MGRRPCCAKE GLNRGIWTAG EDKILVDYIE AHGEGKWRDL PQRAGMYYYH TKRF

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a minor rheostat role in aliphatic glucosinolates (GLSs) biosynthesis, mostly short chained. Together with MYB28/HAG1 and MYB76/HAG2, promotes aliphatic glucosinolate biosynthesis but represses indolic glucosinolate biosynthesis. Prevents insect performance (e.g. lepidopteran insect Mamestra brassicae) by promoting glucosinolates. {ECO:0000269\|PubMed:17420480, ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:18446225, ECO:0000269\|PubMed:20348214, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23792303, ECO:0000269\|PubMed:23943862}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by gibberellic acid (GA), jasmonic acid (JA, MeJA), nitrogen starvation and UV LIGHT treatment. Transiently repressed by salicylic acid (SA). Accumulates upon mechanical stimuli (e.g. wounding) in inflorescence. Down-regulated by sulfur-deficient stress. {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:23792303, ECO:0000269\|PubMed:9839469}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010049530.1	1e-27	PREDICTED: transcription factor TT2
Swissprot	Q9FLR1	3e-17	MYB29_ARATH; Transcription factor MYB29
TrEMBL	A0A059CUV1	3e-26	A0A059CUV1_EUCGR; Uncharacterized protein
STRING	XP_010049530.1	5e-27	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G07690.1	1e-19	myb domain protein 29

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Kim K,Jiang K,Teng SL,Feldman LJ,Huang H Using biologically interrelated experiments to identify pathway genes in Arabidopsis. Bioinformatics, 2012. 28(6): p. 815-22 [PMID:22271267] Araki R, et al. Novel bioresources for studies of Brassica oleracea: identification of a kale MYB transcription factor responsible for glucosinolate production. Plant Biotechnol. J., 2013. 11(8): p. 1017-27 [PMID:23910994] Guo R, et al. Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(18): p. 5707-19 [PMID:24151308] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Burow M, et al. The Glucosinolate Biosynthetic Gene AOP2 Mediates Feed-back Regulation of Jasmonic Acid Signaling in Arabidopsis. Mol Plant, 2015. 8(8): p. 1201-12 [PMID:25758208] Martínez-Ballesta M, et al. The impact of the absence of aliphatic glucosinolates on water transport under salt stress in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 524 [PMID:26236322] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Mostafa I, et al. New nodes and edges in the glucosinolate molecular network revealed by proteomics and metabolomics of Arabidopsis myb28/29 and cyp79B2/B3 glucosinolate mutants. J Proteomics, 2016. 138: p. 1-19 [PMID:26915584] Smith JD,Woldemariam MG,Mescher MC,Jander G,De Moraes CM Glucosinolates from Host Plants Influence Growth of the Parasitic Plant Cuscuta gronovii and Its Susceptibility to Aphid Feeding. Plant Physiol., 2016. 172(1): p. 181-97 [PMID:27482077] Zhang X, et al. The Transcription Factor MYB29 Is a Regulator of ALTERNATIVE OXIDASE1a. Plant Physiol., 2017. 173(3): p. 1824-1843 [PMID:28167700] Mostafa I, et al. Membrane Proteomics of Arabidopsis Glucosinolate Mutants cyp79B2/B3 and myb28/29. Front Plant Sci, 2017. 8: p. 534 [PMID:28443122] Li B, et al. Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis. Plant Cell, 2018. 30(1): p. 178-195 [PMID:29317470]