PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G07690.1

Common Name

ATMYB29, HAG3, MBK20.15, MYB29, PMG2

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 336aa MW: 37966 Da PI: 4.969

Description

myb domain protein 29

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G07690.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.8	2.4e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl AT5G07690.1 14 KGAWTAEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWANYL 61 79********************************************97 PP
2	Myb_DNA-binding	46.6	7.7e-15	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++ eE+++++ +++ G++ W+ Iar+++ +Rt++++k++w+++l AT5G07690.1 67 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEIKNYWNTHL 112 899*****************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.5E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.277	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	4.31E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	2.4E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-17	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	6.20E-11	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.7E-24	65	114	IPR009057	Homeodomain-like
SMART	SM00717	2.5E-13	66	114	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	18.797	66	116	IPR017930	Myb domain
Pfam	PF00249	1.9E-13	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	1.19E-9	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009414	Biological Process	response to water deprivation
GO:0009611	Biological Process	response to wounding
GO:0009625	Biological Process	response to insect
GO:0009682	Biological Process	induced systemic resistance
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010438	Biological Process	cellular response to sulfur starvation
GO:0010439	Biological Process	regulation of glucosinolate biosynthetic process
GO:0030154	Biological Process	cell differentiation
GO:0050832	Biological Process	defense response to fungus
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0006325	anatomy	inflorescence node
PO:0008019	anatomy	leaf lamina base
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 336 aa Download sequence Send to blast
MSRKPCCVGE GLKKGAWTAE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWANY 60 LKPDIKRGEF SYEEEQIIIM LHASRGNKWS VIARHLPKRT DNEIKNYWNT HLKKLLIDKG 120 IDPVTHKPLA YDSNPDEQSQ SGSISPKSLP PSSSKNVPEI TSSDETPKYD ASLSSKKRCF 180 KRSSSTSKLL NKVAARASSM GTILGASIEG TLISSTPLSS CLNDDFSETS QFQMEEFDPF 240 YQSSEHIIDH MKEDISINNS EYDFSQFLEQ FSNNEGEEAD NTGGGYNQDL LMSDVSSTSV 300 DEDEMMQNIT GWSNYLLDHS DFNYDTSQDY DDKNFI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	5e-24	12	114	25	126	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	14334943	0.0
Genevisible	250598_at	0.0
Expression Atlas	AT5G07690	-
AtGenExpress	AT5G07690	-
ATTED-II	AT5G07690	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Primarily present around the midvein in seedlings. Accumulates gradually in expanding leaves, reaching a maximum in fully expanded leaves in the primary vein. {ECO:0000269\|PubMed:18042203}.
Uniprot	TISSUE SPECIFICITY: Expressed in both vegetative and generative organs. Mostly present in seedlings, inflorescences, roots and stems, and, to a lower extent, in leaves (in midvein and trichomes) and siliques. {ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:23115560, ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a putative transcription factor (MYB29).
UniProt	Plays a minor rheostat role in aliphatic glucosinolates (GLSs) biosynthesis, mostly short chained. Together with MYB28/HAG1 and MYB76/HAG2, promotes aliphatic glucosinolate biosynthesis but represses indolic glucosinolate biosynthesis. Prevents insect performance (e.g. lepidopteran insect Mamestra brassicae) by promoting glucosinolates. {ECO:0000269\|PubMed:17420480, ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:18446225, ECO:0000269\|PubMed:20348214, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23792303, ECO:0000269\|PubMed:23943862}.

Function -- GeneRIF ? help Back to Top
Myb29 presumably plays an accessory function for methyl jasmonate-mediated induction of a set of aliphatic glucosinolate biosynthetic genes. [PMID: 17420480] HAG1/MYB28, HAG2/MYB76 and HAG3/MYB29 reciprocally transactivated each other in the control of aliphatic glucosinolate biosynthesis and downregulated the expression of genes involved in the control of indolic glucosinolate biosynthesis. [PMID: 18042203] MYB76 is not dependent on MYB28 and MYB29 for induction of aliphatic glucosinolates. [PMID: 20348214] MYB28 and MYB29 synergistically functioned in the glucose-induced biosynthesis of aliphatic glucosinolates, but MYB28 was predominant over MYB29. [PMID: 23329848] MYB28 expression was induced by sulfur deficiency, while the expression levels of MYB29 and MYB76 were positively correlated with sulfur concentration. [PMID: 23792303] MYB DOMAIN PROTEIN29 (MYB29) mutants have increased levels of ALTERNATIVE OXIDASE1a (AOX1a) transcript and protein compared to wild type after induction with antimycin A. [PMID: 28167700]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G07690.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by gibberellic acid (GA), jasmonic acid (JA, MeJA), nitrogen starvation and UV LIGHT treatment. Transiently repressed by salicylic acid (SA). Accumulates upon mechanical stimuli (e.g. wounding) in inflorescence. Down-regulated by sulfur-deficient stress. {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:23792303, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G16400(A), AT1G16410(A), AT4G13770(A), AT5G23010(A), AT5G61420(R)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	gibberellin, jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G46760, AT5G46830, AT1G32640

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Low levels of aliphatic glucosinolates. {ECO:0000269\|PubMed:23580754}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G07690

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY035145	0.0	AY035145.1 Arabidopsis thaliana putative transcription factor (At5g07690) mRNA, complete cds.
GenBank	AY059078	0.0	AY059078.1 Arabidopsis thaliana putative transcription factor (At5g07690) mRNA, complete cds.
GenBank	AY519617	0.0	AY519617.1 Arabidopsis thaliana MYB transcription factor (At5g07690) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_196386.1	0.0	myb domain protein 29
Swissprot	Q9FLR1	0.0	MYB29_ARATH; Transcription factor MYB29
TrEMBL	D7M0L6	0.0	D7M0L6_ARALL; Uncharacterized protein
STRING	AT5G07690.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3787	18	60
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT5G07690.1
Entrez Gene	830662
iHOP	AT5G07690
wikigenes	AT5G07690

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Li J,Brader G,Palva ET The WRKY70 transcription factor: a node of convergence for jasmonate-mediated and salicylate-mediated signals in plant defense. Plant Cell, 2004. 16(2): p. 319-31 [PMID:14742872] Goda H, et al. Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. Plant Physiol., 2004. 134(4): p. 1555-73 [PMID:15047898] Stanley Kim H, et al. Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome. Plant J., 2005. 41(2): p. 212-20 [PMID:15634198] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Millenaar FF, et al. How to decide? Different methods of calculating gene expression from short oligonucleotide array data will give different results. BMC Bioinformatics, 2006. 7: p. 137 [PMID:16539732] Knight CA, et al. Expression profiling and local adaptation of Boechera holboellii populations for water use efficiency across a naturally occurring water stress gradient. Mol. Ecol., 2006. 15(5): p. 1229-37 [PMID:16626450] Hirai MY, et al. Omics-based identification of Arabidopsis Myb transcription factors regulating aliphatic glucosinolate biosynthesis. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(15): p. 6478-83 [PMID:17420480] Swindell WR,Huebner M,Weber AP Plastic and adaptive gene expression patterns associated with temperature stress in Arabidopsis thaliana. Heredity (Edinb), 2007. 99(2): p. 143-50 [PMID:17473866] Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. Plant Physiol., 2007. 144(3): p. 1391-406 [PMID:17478635] Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana. New Phytol., 2008. 177(3): p. 627-42 [PMID:18042203] S A systems biology approach identifies a R2R3 MYB gene subfamily with distinct and overlapping functions in regulation of aliphatic glucosinolates. PLoS ONE, 2007. 2(12): p. e1322 [PMID:18094747] Beekwilder J, et al. The impact of the absence of aliphatic glucosinolates on insect herbivory in Arabidopsis. PLoS ONE, 2008. 3(4): p. e2068 [PMID:18446225] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Malitsky S, et al. The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators. Plant Physiol., 2008. 148(4): p. 2021-49 [PMID:18829985] S A complex interplay of three R2R3 MYB transcription factors determines the profile of aliphatic glucosinolates in Arabidopsis. Plant Physiol., 2010. 153(1): p. 348-63 [PMID:20348214] M Differential effects of indole and aliphatic glucosinolates on lepidopteran herbivores. J. Chem. Ecol., 2010. 36(8): p. 905-13 [PMID:20617455] Stotz HU, et al. Role of camalexin, indole glucosinolates, and side chain modification of glucosinolate-derived isothiocyanates in defense of Arabidopsis against Sclerotinia sclerotiorum. Plant J., 2011. 67(1): p. 81-93 [PMID:21418358] Kim K,Jiang K,Teng SL,Feldman LJ,Huang H Using biologically interrelated experiments to identify pathway genes in Arabidopsis. Bioinformatics, 2012. 28(6): p. 815-22 [PMID:22271267] van de Mortel JE, et al. Metabolic and transcriptomic changes induced in Arabidopsis by the rhizobacterium Pseudomonas fluorescens SS101. Plant Physiol., 2012. 160(4): p. 2173-88 [PMID:23073694] Frerigmann H,B Glucosinolates are produced in trichomes of Arabidopsis thaliana. Front Plant Sci, 2012. 3: p. 242 [PMID:23115560] Mewis I,Khan MA,Glawischnig E,Schreiner M,Ulrichs C Water stress and aphid feeding differentially influence metabolite composition in Arabidopsis thaliana (L.). PLoS ONE, 2012. 7(11): p. e48661 [PMID:23144921] Miao H, et al. Glucose signalling positively regulates aliphatic glucosinolate biosynthesis. J. Exp. Bot., 2013. 64(4): p. 1097-109 [PMID:23329848] Guo R, et al. BZR1 and BES1 participate in regulation of glucosinolate biosynthesis by brassinosteroids in Arabidopsis. J. Exp. Bot., 2013. 64(8): p. 2401-12 [PMID:23580754] Li Y, et al. Novel insights into the function of Arabidopsis R2R3-MYB transcription factors regulating aliphatic glucosinolate biosynthesis. Plant Cell Physiol., 2013. 54(8): p. 1335-44 [PMID:23792303] Araki R, et al. Novel bioresources for studies of Brassica oleracea: identification of a kale MYB transcription factor responsible for glucosinolate production. Plant Biotechnol. J., 2013. 11(8): p. 1017-27 [PMID:23910994] Schweizer F, et al. Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior. Plant Cell, 2013. 25(8): p. 3117-32 [PMID:23943862] Guo R, et al. Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(18): p. 5707-19 [PMID:24151308] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Berger B,Gigolashvili T bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis. Plant Physiol., 2014. 166(1): p. 349-69 [PMID:25049362] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Burow M, et al. The Glucosinolate Biosynthetic Gene AOP2 Mediates Feed-back Regulation of Jasmonic Acid Signaling in Arabidopsis. Mol Plant, 2015. 8(8): p. 1201-12 [PMID:25758208] Martínez-Ballesta M, et al. The impact of the absence of aliphatic glucosinolates on water transport under salt stress in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 524 [PMID:26236322] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Mostafa I, et al. New nodes and edges in the glucosinolate molecular network revealed by proteomics and metabolomics of Arabidopsis myb28/29 and cyp79B2/B3 glucosinolate mutants. J Proteomics, 2016. 138: p. 1-19 [PMID:26915584] Smith JD,Woldemariam MG,Mescher MC,Jander G,De Moraes CM Glucosinolates from Host Plants Influence Growth of the Parasitic Plant Cuscuta gronovii and Its Susceptibility to Aphid Feeding. Plant Physiol., 2016. 172(1): p. 181-97 [PMID:27482077] Zhang X, et al. The Transcription Factor MYB29 Is a Regulator of ALTERNATIVE OXIDASE1a. Plant Physiol., 2017. 173(3): p. 1824-1843 [PMID:28167700] Mostafa I, et al. Membrane Proteomics of Arabidopsis Glucosinolate Mutants cyp79B2/B3 and myb28/29. Front Plant Sci, 2017. 8: p. 534 [PMID:28443122] Li B, et al. Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis. Plant Cell, 2018. 30(1): p. 178-195 [PMID:29317470] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]