PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC016645.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 10203.8 Da PI: 9.8051 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 64.8 | 1.7e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEde l+++vk +G g W+++a+ g++R++k+c++rw++yl EcC016645.10 14 KGAWSAEEDEVLINYVKIHGEGKWRRVAQNAGLNRCAKSCRLRWLNYL 61 79*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.0E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 27.174 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-16 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.18E-23 | 15 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.44E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.5E-7 | 65 | 87 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.452 | 66 | 87 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MVRRPCCDKQ RTNKGAWSAE EDEVLINYVK IHGEGKWRRV AQNAGLNRCA KSCRLRWLNY 60 LRPGIKRGDI TEDEEDLIIR LHRLLGN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-13 | 13 | 87 | 26 | 99 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010033737.1 | 1e-55 | PREDICTED: protein ODORANT1 | ||||
Swissprot | P10290 | 1e-38 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A059AI79 | 2e-54 | A0A059AI79_EUCGR; Uncharacterized protein | ||||
STRING | XP_010033737.1 | 4e-55 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 1e-39 | myb domain protein 4 |