PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT4G38620.1

Common Name

ATMYB4, F20M13.180, MYB4

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 282aa MW: 31808.4 Da PI: 8.7595

Description

myb domain protein 4

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G38620.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.9	9.7e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv ++k +G g+W++ ++ g+ R++k+c++rw +yl AT4G38620.1 14 KGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	59.9	5.4e-19	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++ AT4G38620.1 67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.0E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.051	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	3.95E-30	13	108	IPR009057	Homeodomain-like
SMART	SM00717	8.5E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	3.2E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.11E-10	16	61	No hit	No description
PROSITE profile	PS51294	29.411	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.4E-28	65	117	IPR009057	Homeodomain-like
SMART	SM00717	6.3E-18	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.6E-17	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	4.67E-13	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010224	Biological Process	response to UV-B
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0090379	Biological Process	secondary cell wall biogenesis involved in seed trichome differentiation
GO:1903086	Biological Process	negative regulation of sinapate ester biosynthetic process
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0003677	Molecular Function	DNA binding
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 282 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLINRG 120 IDPTSHRPIQ ESSASQDSKP TQLEPVTSNT INISFTSAPK VETFHESISF PGKSEKISML 180 TFKEEKDECP VQEKFPDLNL ELRISLPDDV DRLQGHGKST TPRCFKCSLG MINGMECRCG 240 RMRCDVVGGS SKGSDMSNGF DFLGLAKKET TSLLGFRSLE MK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	8e-30	13	116	26	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.20521	0.0	cell culture\| flower\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30692030	0.0
Genevisible	252958_at	0.0
Expression Atlas	AT4G38620	-
AtGenExpress	AT4G38620	-
ATTED-II	AT4G38620	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a R2R3 MYB protein which is involved in the response to UV-B. It functions as a repressor of target gene expression. One of its target genes encodes cinnamate 4-hydroxylase; mutants accumulate sinapate esters in their leaves. MYB4 binds to its own promoter and represses its own expression. Nuclear localization of MYB4 depends on the action of the beta importin SAD2.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Function -- GeneRIF ? help Back to Top
Arabidopsis thaliana mutant sensitive to ABA and drought2 (sad2), which harbors a T-DNA insertion in an importin beta-like gene, is more tolerant to UV-B radiation than the wild type. [PMID: 17993626]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00479	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G38620.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT4G38620 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G51680(R), AT1G65060(R), AT2G30490(R), AT3G53260(A), AT4G38620(R), AT5G13930(R)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q9SZP1

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Defects lead to a better tolerance of UV-B irradiation due to the increase in sinapate ester accumulation. {ECO:0000269\|PubMed:11080161}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G38620

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY070100	0.0	AY070100.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds.
GenBank	AY123004	0.0	AY123004.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds.
GenBank	AY140037	0.0	AY140037.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds.
GenBank	AY519615	0.0	AY519615.1 Arabidopsis thaliana MYB transcription factor (At4g38620) mRNA, complete cds.
GenBank	BT006302	0.0	BT006302.1 Arabidopsis thaliana At4g38620 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_195574.1	0.0	myb domain protein 4
Swissprot	Q9SZP1	0.0	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A178UYJ1	0.0	A0A178UYJ1_ARATH; MYB4
STRING	AT4G38620.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT4G38620.1
Entrez Gene	830018
iHOP	AT4G38620
wikigenes	AT4G38620

Publications ? help Back to Top
Jin H, et al. Transcriptional repression by AtMYB4 controls production of UV-protecting sunscreens in Arabidopsis. EMBO J., 2000. 19(22): p. 6150-61 [PMID:11080161] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Song W,Solimeo H,Rupert RA,Yadav NS,Zhu Q Functional dissection of a Rice Dr1/DrAp1 transcriptional repression complex. Plant Cell, 2002. 14(1): p. 181-95 [PMID:11826307] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Vannini C, et al. Overexpression of the rice Osmyb4 gene increases chilling and freezing tolerance of Arabidopsis thaliana plants. Plant J., 2004. 37(1): p. 115-27 [PMID:14675437] Gong W, et al. Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes. Plant Physiol., 2004. 135(2): p. 773-82 [PMID:15208423] Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. Plant J., 2004. 40(1): p. 22-34 [PMID:15361138] Preston J,Wheeler J,Heazlewood J,Li SF,Parish RW AtMYB32 is required for normal pollen development in Arabidopsis thaliana. Plant J., 2004. 40(6): p. 979-95 [PMID:15584962] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Zhao J, et al. SAD2, an importin -like protein, is required for UV-B response in Arabidopsis by mediating MYB4 nuclear trafficking. Plant Cell, 2007. 19(11): p. 3805-18 [PMID:17993626] Lee Y,Lee HS,Lee JS,Kim SK,Kim SH Hormone- and light-regulated nucleocytoplasmic transport in plants: current status. J. Exp. Bot., 2008. 59(12): p. 3229-45 [PMID:18678754] Pan Y, et al. Cytochrome P450 monooxygenases as reporters for circadian-regulated pathways. Plant Physiol., 2009. 150(2): p. 858-78 [PMID:19386812] Kram BW,Xu WW,Carter CJ Uncovering the Arabidopsis thaliana nectary transcriptome: investigation of differential gene expression in floral nectariferous tissues. BMC Plant Biol., 2009. 9: p. 92 [PMID:19604393] Colquhoun TA, et al. PhMYB4 fine-tunes the floral volatile signature of Petunia x hybrida through PhC4H. J. Exp. Bot., 2011. 62(3): p. 1133-43 [PMID:21068208] Schenke D,B Crosstalk between abiotic ultraviolet-B stress and biotic (flg22) stress signalling in Arabidopsis prevents flavonol accumulation in favor of pathogen defence compound production. Plant Cell Environ., 2011. 34(11): p. 1849-64 [PMID:21707654] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Datta R,Sinha R,Chattopadhyay S Changes in leaf proteome profile of Arabidopsis thaliana in response to salicylic acid. J. Biosci., 2013. 38(2): p. 317-28 [PMID:23660666] Fornal AtMYB7, a new player in the regulation of UV-sunscreens in Arabidopsis thaliana. Plant Cell Physiol., 2014. 55(3): p. 507-16 [PMID:24319076] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604] Romero I, et al. More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis thaliana. Plant J., 1998. 14(3): p. 273-84 [PMID:9628022] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]