PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ciclev10017654m

Common Name

CICLE_v10017654mg

Organism

Citrus clementina

Taxonomic ID

85681

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

MYB

Protein Properties

Length: 215aa MW: 24178.3 Da PI: 8.683

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10017654m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.8	2.1e-17	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++l+d+++++G g+W+t ++ g+ R++k+c++rw +yl Ciclev10017654m 13 KGAWSKQEDQKLIDYIRKHGEGCWRTLPQAAGLARCGKSCRLRWINYL 60 79********************************************97 PP
2	Myb_DNA-binding	51.7	2e-16	66	111	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l Ciclev10017654m 66 RGNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTANEVKNYWNSHL 111 8999****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.5E-24	4	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.77	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	4.12E-28	11	107	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-12	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-15	13	60	IPR001005	SANT/Myb domain
CDD	cd00167	2.23E-10	15	60	No hit	No description
PROSITE profile	PS51294	26.525	61	115	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-25	64	116	IPR009057	Homeodomain-like
SMART	SM00717	1.5E-15	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	3.8E-15	66	111	IPR001005	SANT/Myb domain
CDD	cd00167	9.91E-11	68	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 215 aa Download sequence Send to blast
MRKPCCDKQD TNKGAWSKQE DQKLIDYIRK HGEGCWRTLP QAAGLARCGK SCRLRWINYL 60 RPDLKRGNFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTA NEVKNYWNSH LRRKLINMGI 120 DPKNHRLHHS LPHNSTGATS LGQQLVDMNE PAVKPRGDDI YQASDAGSCW EDEPCRLLPD 180 LNLDLTMSIP SSSSSPSLAN KANTEKKNDS ELPN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-29	10	115	4	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ126857	1e-110	KJ126857.1 Malus hybrid cultivar MYB2 (MYB2) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006448287.1	1e-158	myb-related protein 308
Refseq	XP_006495052.1	1e-158	myb-related protein 308
Swissprot	Q9SZP1	5e-74	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A2H5PQP2	1e-156	A0A2H5PQP2_CITUN; Uncharacterized protein
TrEMBL	V4U6E9	1e-156	V4U6E9_9ROSI; Uncharacterized protein
STRING	XP_006495052.1	1e-157	(Citrus sinensis)
STRING	XP_006448287.1	1e-157	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09460.1	4e-75	myb domain protein 6

Link Out ? help Back to Top
Phytozome	Ciclev10017654m
Entrez Gene	18053562

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]