PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G09460.1 | ||||||||
Common Name | AtMYB6, MYB6, T15G18.120 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 236aa MW: 26473.7 Da PI: 8.4808 | ||||||||
Description | myb domain protein 6 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.6 | 2.8e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lvd+++ +G g+W++ ++ g+ R++k+c++rw +yl AT4G09460.1 14 KGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 56 | 9.2e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T +Ed+++++++ +lG++ W++Ia +++ gRt++++k++w+++ AT4G09460.1 67 RGNFTDDEDQIIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.6E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.76 | 9 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 4.5E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.95E-29 | 13 | 108 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.5E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.85E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 28.211 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-27 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.7E-16 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.59E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0090378 | Biological Process | seed trichome elongation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001017 | developmental stage | M germinated pollen stage | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 236 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDQRLVDYIR NHGEGCWRSL PKSAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TDDEDQIIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSHG 120 IDPQTHRQIN ESKTVSSQVV VPIQNDAVEY SFSNLAVKPK TENSSDNGAS TSGTTTDEDL 180 RQNGECYYSD NSGHIKLNLD LTLGFGSWSG RIVGVGSSAD SKPWCDPVME ARLSLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-30 | 14 | 116 | 7 | 108 | B-MYB |
1h8a_C | 5e-30 | 13 | 116 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.4218 | 0.0 | floral meristem| flower |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30681083 | 0.0 | ||||
Genevisible | 255037_at | 0.0 | ||||
Expression Atlas | AT4G09460 | - | ||||
AtGenExpress | AT4G09460 | - | ||||
ATTED-II | AT4G09460 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, flower buds, and siliques. {ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes myb6 DNA-binding protein. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G09460.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
IntAct | Search Q38851 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G09460 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | ATU26936 | 0.0 | U26936.1 Arabidopsis thaliana clone myb6 DNA-binding protein mRNA, complete cds. | |||
GenBank | AY086813 | 0.0 | AY086813.1 Arabidopsis thaliana clone 28019 mRNA, complete sequence. | |||
GenBank | AY519604 | 0.0 | AY519604.1 Arabidopsis thaliana MYB transcription factor (At4g09460) mRNA, complete cds. | |||
GenBank | BT004171 | 0.0 | BT004171.1 Arabidopsis thaliana clone RAFL15-40-D03 (R20880) putative myb family transcription factor (At4g09460) mRNA, complete cds. | |||
GenBank | BT005085 | 0.0 | BT005085.1 Arabidopsis thaliana clone U20880 putative myb family transcription factor (At4g09460) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_192684.1 | 1e-176 | myb domain protein 6 | ||||
Swissprot | Q38851 | 1e-177 | MYB6_ARATH; Transcription repressor MYB6 | ||||
TrEMBL | A0A178UZB8 | 1e-175 | A0A178UZB8_ARATH; MYB6 | ||||
STRING | AT4G09460.1 | 1e-175 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G09460.1 |
Entrez Gene | 826530 |
iHOP | AT4G09460 |
wikigenes | AT4G09460 |