PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa11g001570.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 233aa MW: 26497.2 Da PI: 9.1387 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.3 | 7.1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv ++k +G g+W++ ++ g+ R++k+c++rw +yl Csa11g001570.1 14 KGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 60.4 | 4e-19 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++ Csa11g001570.1 67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.051 | 9 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 8.5E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.61E-30 | 13 | 108 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.75E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 29.411 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-28 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3E-18 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-17 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.45E-13 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDERLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLINRG 120 IDPTTHRPIQ ESSASQDSKP TQVEPVTSNT INISFASAPK VETFQETVSF PGKSEKISML 180 TFKEEKNECQ VEEKFPDLNL ELRISLPDDV DRRQGLVGRG KSTTPRCFKC SLG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-30 | 13 | 116 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa11g001570.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY070100 | 0.0 | AY070100.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds. | |||
GenBank | AY123004 | 0.0 | AY123004.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds. | |||
GenBank | AY140037 | 0.0 | AY140037.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds. | |||
GenBank | AY519615 | 0.0 | AY519615.1 Arabidopsis thaliana MYB transcription factor (At4g38620) mRNA, complete cds. | |||
GenBank | BT006302 | 0.0 | BT006302.1 Arabidopsis thaliana At4g38620 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010436960.1 | 1e-173 | PREDICTED: transcription repressor MYB4 | ||||
Swissprot | Q9SZP1 | 1e-162 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | D7MFL7 | 1e-160 | D7MFL7_ARALL; Uncharacterized protein | ||||
STRING | XP_010436959.1 | 1e-173 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 1e-165 | myb domain protein 4 |