PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa05g070890.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

MYB_related

Protein Properties

Length: 161aa MW: 18390.4 Da PI: 4.1683

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa05g070890.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.1	5.6e-15	22	66	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg +T +E +ll++++k+l ++ W++Ia +++ gRt++++k++w ++ Csa05g070890.1 22 RGEFTSDEVDLLLRLHKLLRNR-WSLIAGRLP-GRTANDVKNYWKTH 66 899*****************.*****.*********987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.2E-5	2	28	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.83E-17	2	67	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.063	17	71	IPR017930	Myb domain
SMART	SM00717	5.5E-13	21	69	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-13	22	66	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.8E-17	29	66	IPR009057	Homeodomain-like
CDD	cd00167	2.40E-5	44	67	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
LNRCCKSCRE SLLNYLNPNI NRGEFTSDEV DLLLRLHKLL RNRWSLIAGR LPGRTANDVK 60 NYWKTHFVSI LSYNGCSQLS DKTEVGLSEV SNVDEEKYEL LNSEMDGEIT WWESLLEQNQ 120 EANAEDPIAT TINEEDCTSM DSMSPMFDTE QLWSLFNAEG *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-13	2	63	39	100	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3. Promotes the synthesis of phenylpropanoid-derived compounds such as anthocyanins. {ECO:0000269\|PubMed:11148285, ECO:0000269\|PubMed:15361138}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa05g070890.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By sucrose, nitrogen deficiency, ethylene, UV light and drought. {ECO:0000269\|PubMed:17053893, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF062915	8e-33	AF062915.2 Arabidopsis thaliana putative transcription factor (MYB90) mRNA, MYB90-Col allele, complete cds.
GenBank	AF325124	8e-33	AF325124.1 Arabidopsis thaliana production of anthocyanin pigment 2 protein (PAP2) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019082921.1	5e-81	PREDICTED: transcription factor MYB114-like isoform X1
Refseq	XP_019093300.1	5e-81	PREDICTED: transcription factor MYB114-like
Swissprot	Q9ZTC3	1e-34	MYB90_ARATH; Transcription factor MYB90
TrEMBL	R0I0F5	8e-60	R0I0F5_9BRAS; Uncharacterized protein
STRING	XP_010474137.1	2e-80	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G66390.1	2e-35	myb domain protein 90

Publications ? help Back to Top
Ilk N,Ding J,Ihnatowicz A,Koornneef M,Reymond M Natural variation for anthocyanin accumulation under high-light and low-temperature stress is attributable to the ENHANCER OF AG-4 2 (HUA2) locus in combination with PRODUCTION OF ANTHOCYANIN PIGMENT1 (PAP1) and PAP2. New Phytol., 2015. 206(1): p. 422-35 [PMID:25425527] Li T, et al. Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis. Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83 [PMID:25450360] Nemie-Feyissa D,Heidari B,Blaise M,Lillo C Analysis of interactions between heterologously produced bHLH and MYB proteins that regulate anthocyanin biosynthesis: quantitative interaction kinetics by Microscale Thermophoresis. Phytochemistry, 2015. 111: p. 21-6 [PMID:25659750] Bac-Molenaar JA,Fradin EF,Rienstra JA,Vreugdenhil D,Keurentjes JJ GWA Mapping of Anthocyanin Accumulation Reveals Balancing Selection of MYB90 in Arabidopsis thaliana. PLoS ONE, 2015. 10(11): p. e0143212 [PMID:26588092] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Li N, et al. The heterologous expression of Arabidopsis PAP2 induces anthocyanin accumulation and inhibits plant growth in tomato. Funct. Integr. Genomics, 2018. 18(3): p. 341-353 [PMID:29372433]