PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G66390.1

Common Name

ATMYB90, MYB90, PAP2, T27F4.14

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 249aa MW: 28100.1 Da PI: 8.4893

Description

myb domain protein 90

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G66390.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.6	1.9e-15	10	57	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd ll ++ ++G g W+ ++ + g++R++k+c++rw++yl AT1G66390.1 10 KGAWTAEEDSLLRLCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57 79********************************************97 PP
2	Myb_DNA-binding	48.8	1.7e-15	63	108	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgr + +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l AT1G66390.1 63 RGRLSNDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108 8999****************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.3E-21	5	59	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.103	5	57	IPR017930	Myb domain
SuperFamily	SSF46689	1.2E-27	7	104	IPR009057	Homeodomain-like
SMART	SM00717	1.0E-13	9	59	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-14	10	57	IPR001005	SANT/Myb domain
CDD	cd00167	6.74E-10	12	57	No hit	No description
PROSITE profile	PS51294	24.806	58	112	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.8E-22	60	111	IPR009057	Homeodomain-like
SMART	SM00717	7.7E-15	62	110	IPR001005	SANT/Myb domain
Pfam	PF00249	7.5E-14	63	108	IPR001005	SANT/Myb domain
CDD	cd00167	1.59E-6	83	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0030154	Biological Process	cell differentiation
GO:0080167	Biological Process	response to karrikin
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009009	anatomy	plant embryo
PO:0009029	anatomy	stamen
PO:0009031	anatomy	sepal
PO:0009047	anatomy	stem
PO:0025022	anatomy	collective leaf structure
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 249 aa Download sequence Send to blast
MEGSSKGLRK GAWTAEEDSL LRLCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS 60 IKRGRLSNDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHESSCCKSK 120 MKKKNIISPP TTPVQKIGVF KPRPRSFSVN NGCSHLNGLP EVDLIPSCLG LKKNNVCENS 180 ITCNKDDEKD DFVNNLMNGD NMWLENLLGE NQEADAIVPE ATTAEHGATL AFDVEQLWSL 240 FDGETVELD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	6e-21	8	111	5	107	B-MYB
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	225166515	0.0
Genevisible	260140_at	0.0
Expression Atlas	AT1G66390	-
AtGenExpress	AT1G66390	-
ATTED-II	AT1G66390	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed only in leaves and siliques. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
TAIR	production of anthocyanin pigment 2 protein (PAP2)
UniProt	Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3. Promotes the synthesis of phenylpropanoid-derived compounds such as anthocyanins. {ECO:0000269\|PubMed:11148285, ECO:0000269\|PubMed:15361138}.

Function -- GeneRIF ? help Back to Top
the mutant myb transgene product from Arabidopsis acts as a competitive inhibitor of the native tobacco NtAN2 protein [PMID: 20360951] Data indicate that miR828, TAS4-siRNA81(-), and its targets MYB transcription factors PAP1 and PAP2 are responsive to sucrose. [PMID: 21533841] The observed reduction in anthocyanin pigmentation and AtMYB90 mRNA was phenotypically identical to the patterns seen in leaves systemically silenced for the AtMYB90 transgene. [PMID: 22363419] The COP1/SPA complex affects PAP1 and PAP2 both transcriptionally and post-translationally. The COP1/SPA complex controls anthocyanin levels in Arabidopsis. [PMID: 23425305]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G66390.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By sucrose, nitrogen deficiency, ethylene, UV light and drought. {ECO:0000269\|PubMed:17053893, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G56650 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT2G37260(A)

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q9ZTC3

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G66390

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF062915	0.0	AF062915.2 Arabidopsis thaliana putative transcription factor (MYB90) mRNA, MYB90-Col allele, complete cds.
GenBank	AF325124	0.0	AF325124.1 Arabidopsis thaliana production of anthocyanin pigment 2 protein (PAP2) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_176813.1	0.0	myb domain protein 90
Swissprot	Q9ZTC3	0.0	MYB90_ARATH; Transcription factor MYB90
TrEMBL	A0A178WHT8	0.0	A0A178WHT8_ARATH; PAP2
STRING	AT1G66390.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT1G66390.1
Entrez Gene	842957
iHOP	AT1G66390
wikigenes	AT1G66390

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Borevitz JO,Xia Y,Blount J,Dixon RA,Lamb C Activation tagging identifies a conserved MYB regulator of phenylpropanoid biosynthesis. Plant Cell, 2000. 12(12): p. 2383-2394 [PMID:11148285] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Zhang F,Gonzalez A,Zhao M,Payne CT,Lloyd A A network of redundant bHLH proteins functions in all TTG1-dependent pathways of Arabidopsis. Development, 2003. 130(20): p. 4859-69 [PMID:12917293] Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. Plant J., 2004. 40(1): p. 22-34 [PMID:15361138] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Lea US,Slimestad R,Smedvig P,Lillo C Nitrogen deficiency enhances expression of specific MYB and bHLH transcription factors and accumulation of end products in the flavonoid pathway. Planta, 2007. 225(5): p. 1245-53 [PMID:17053893] Ishida T, et al. Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation. Plant Cell, 2007. 19(8): p. 2531-43 [PMID:17766401] Gao P,Xin Z,Zheng ZL The OSU1/QUA2/TSD2-encoded putative methyltransferase is a critical modulator of carbon and nitrogen nutrient balance response in Arabidopsis. PLoS ONE, 2008. 3(1): p. e1387 [PMID:18167546] Dubos C, et al. MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana. Plant J., 2008. 55(6): p. 940-53 [PMID:18532978] Loreti E, et al. Gibberellins, jasmonate and abscisic acid modulate the sucrose-induced expression of anthocyanin biosynthetic genes in Arabidopsis. New Phytol., 2008. 179(4): p. 1004-16 [PMID:18537890] Olsen KM, et al. Temperature and nitrogen effects on regulators and products of the flavonoid pathway: experimental and kinetic model studies. Plant Cell Environ., 2009. 32(3): p. 286-99 [PMID:19054348] Rowan DD, et al. Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana. New Phytol., 2009. 182(1): p. 102-15 [PMID:19192188] Shan X,Zhang Y,Peng W,Wang Z,Xie D Molecular mechanism for jasmonate-induction of anthocyanin accumulation in Arabidopsis. J. Exp. Bot., 2009. 60(13): p. 3849-60 [PMID:19596700] Feyissa DN,Løvdal T,Olsen KM,Slimestad R,Lillo C The endogenous GL3, but not EGL3, gene is necessary for anthocyanin accumulation as induced by nitrogen depletion in Arabidopsis rosette stage leaves. Planta, 2009. 230(4): p. 747-54 [PMID:19621239] Rubin G,Tohge T,Matsuda F,Saito K,Scheible WR Members of the LBD family of transcription factors repress anthocyanin synthesis and affect additional nitrogen responses in Arabidopsis. Plant Cell, 2009. 21(11): p. 3567-84 [PMID:19933203] Nelson DC, et al. Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100 [PMID:20351290] Velten J,Cakir C,Cazzonelli CI A spontaneous dominant-negative mutation within a 35S::AtMYB90 transgene inhibits flower pigment production in tobacco. PLoS ONE, 2010. 5(3): p. e9917 [PMID:20360951] Luo QJ,Mittal A,Jia F,Rock CD An autoregulatory feedback loop involving PAP1 and TAS4 in response to sugars in Arabidopsis. Plant Mol. Biol., 2012. 80(1): p. 117-29 [PMID:21533841] Peng Z, et al. Brassinosteroid enhances jasmonate-induced anthocyanin accumulation in Arabidopsis seedlings. J Integr Plant Biol, 2011. 53(8): p. 632-40 [PMID:21545406] Velten J,Cakir C,Youn E,Chen J,Cazzonelli CI Transgene silencing and transgene-derived siRNA production in tobacco plants homozygous for an introduced AtMYB90 construct. PLoS ONE, 2012. 7(2): p. e30141 [PMID:22363419] Chiu LW,Li L Characterization of the regulatory network of BoMYB2 in controlling anthocyanin biosynthesis in purple cauliflower. Planta, 2012. 236(4): p. 1153-64 [PMID:22644767] Maier A, et al. Light and the E3 ubiquitin ligase COP1/SPA control the protein stability of the MYB transcription factors PAP1 and PAP2 involved in anthocyanin accumulation in Arabidopsis. Plant J., 2013. 74(4): p. 638-51 [PMID:23425305] Li S,Zachgo S TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana. Plant J., 2013. 76(6): p. 901-13 [PMID:24118612] Ilk N,Ding J,Ihnatowicz A,Koornneef M,Reymond M Natural variation for anthocyanin accumulation under high-light and low-temperature stress is attributable to the ENHANCER OF AG-4 2 (HUA2) locus in combination with PRODUCTION OF ANTHOCYANIN PIGMENT1 (PAP1) and PAP2. New Phytol., 2015. 206(1): p. 422-35 [PMID:25425527] Li T, et al. Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis. Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83 [PMID:25450360] Nemie-Feyissa D,Heidari B,Blaise M,Lillo C Analysis of interactions between heterologously produced bHLH and MYB proteins that regulate anthocyanin biosynthesis: quantitative interaction kinetics by Microscale Thermophoresis. Phytochemistry, 2015. 111: p. 21-6 [PMID:25659750] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Bac-Molenaar JA,Fradin EF,Rienstra JA,Vreugdenhil D,Keurentjes JJ GWA Mapping of Anthocyanin Accumulation Reveals Balancing Selection of MYB90 in Arabidopsis thaliana. PLoS ONE, 2015. 10(11): p. e0143212 [PMID:26588092] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Li N, et al. The heterologous expression of Arabidopsis PAP2 induces anthocyanin accumulation and inhibits plant growth in tomato. Funct. Integr. Genomics, 2018. 18(3): p. 341-353 [PMID:29372433] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]