PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa04g067600.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 96aa MW: 10996.6 Da PI: 10.0538 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.7 | 2.3e-17 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgrWT+eEd++l ++++ G g+W++ ++ g++R++k+c++rw +yl Csa04g067600.1 16 RGRWTAEEDQILSNYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINYL 63 8*********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.7E-23 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.292 | 11 | 67 | IPR017930 | Myb domain |
SMART | SM00717 | 6.5E-12 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-15 | 16 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.05E-21 | 17 | 94 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.91E-9 | 18 | 63 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.1E-7 | 67 | 91 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
SXXXXAPCCE KVGIKRGRWT AEEDQILSNY IQSNGEGSWR SLPKNAGLKR CGKSCRLRWI 60 NYLRSDLKRG NISPKEEELV VKLHSTLGNR YFFIY* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00668 | SELEX | Transfer from GRMZM2G016020 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa04g067600.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF062864 | 1e-105 | AF062864.1 Arabidopsis thaliana putative transcription factor (MYB12) mRNA, complete cds. | |||
GenBank | AY060588 | 1e-105 | AY060588.1 Arabidopsis thaliana At2g47460/T30B22.24 mRNA, complete cds. | |||
GenBank | AY142067 | 1e-105 | AY142067.1 Arabidopsis thaliana At2g47460/T30B22.24 mRNA, complete cds. | |||
GenBank | AY519580 | 1e-105 | AY519580.1 Arabidopsis thaliana MYB transcription factor (At2g47460) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010506783.2 | 5e-55 | PREDICTED: transcription factor MYB12-like | ||||
Refseq | XP_010507890.1 | 7e-55 | PREDICTED: transcription factor MYB12 | ||||
Swissprot | O22264 | 5e-55 | MYB12_ARATH; Transcription factor MYB12 | ||||
TrEMBL | A0A178VXG6 | 9e-55 | A0A178VXG6_ARATH; Uncharacterized protein | ||||
TrEMBL | D7LGN2 | 1e-52 | D7LGN2_ARALL; Uncharacterized protein | ||||
STRING | XP_010507890.1 | 3e-54 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47460.1 | 2e-57 | myb domain protein 12 |