PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G47460.1

Common Name

ATMYB12, MYB12, PFG1, T30B22.24

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 371aa MW: 41393.8 Da PI: 4.8556

Description

myb domain protein 12

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G47460.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.2	2.9e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgrWT+eEd++l ++++ G g+W++ ++ g++R++k+c++rw +yl AT2G47460.1 14 RGRWTAEEDQILSNYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINYL 61 8*********************************************97 PP
2	Myb_DNA-binding	56.2	7.7e-18	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ T+eE+el v+++ lG++ W++Ia +++ gRt++++k++w+++l AT2G47460.1 67 RGNITPEEEELVVKLHSTLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112 7999****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.2E-22	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.114	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.46E-28	11	108	IPR009057	Homeodomain-like
SMART	SM00717	6.5E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.0E-14	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	5.94E-9	16	61	No hit	No description
PROSITE profile	PS51294	26.423	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.0E-25	65	116	IPR009057	Homeodomain-like
SMART	SM00717	8.8E-17	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-15	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	5.80E-12	71	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009813	Biological Process	flavonoid biosynthetic process
GO:0030154	Biological Process	cell differentiation
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009052	anatomy	flower pedicel
PO:0020100	anatomy	hypocotyl
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 371 aa Download sequence Send to blast
MGRAPCCEKV GIKRGRWTAE EDQILSNYIQ SNGEGSWRSL PKNAGLKRCG KSCRLRWINY 60 LRSDLKRGNI TPEEEELVVK LHSTLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRKLHNFI 120 RKPSISQDVS AVIMTNASSA PPPPQAKRRL GRTSRSAMKP KIHRTKTRKT KKTSAPPEPN 180 ADVAGADKEA LMVESSGAEA ELGRPCDYYG DDCNKNLMSI NGDNGVLTFD DDIIDLLLDE 240 SDPGHLYTNT TCGGDGELHN IRDSEGARGF SDTWNQGNLD CLLQSCPSVE SFLNYDHQVN 300 DASTDEFIDW DCVWQEGSDN NLWHEKENPD SMVSWLLDGD DEATIGNSNC ENFGEPLDHD 360 DESALVAWLL S

Sequence ? help Back to Top

Protein Sequence Length: 371 aa Download sequence Send to blast

MGRAPCCEKV GIKRGRWTAE EDQILSNYIQ SNGEGSWRSL PKNAGLKRCG KSCRLRWINY  60
LRSDLKRGNI TPEEEELVVK LHSTLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRKLHNFI  120
RKPSISQDVS AVIMTNASSA PPPPQAKRRL GRTSRSAMKP KIHRTKTRKT KKTSAPPEPN  180
ADVAGADKEA LMVESSGAEA ELGRPCDYYG DDCNKNLMSI NGDNGVLTFD DDIIDLLLDE  240
SDPGHLYTNT TCGGDGELHN IRDSEGARGF SDTWNQGNLD CLLQSCPSVE SFLNYDHQVN  300
DASTDEFIDW DCVWQEGSDN NLWHEKENPD SMVSWLLDGD DEATIGNSNC ENFGEPLDHD  360
DESALVAWLL S

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	9e-23	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145361091	0.0
Genevisible	245126_at	0.0
Expression Atlas	AT2G47460	-
AtGenExpress	AT2G47460	-
ATTED-II	AT2G47460	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: In seedlings, predominantly expressed in roots. Expressed predominantly in the root, in the vascular tissue of the hypocotyl-root transition zone and, at low levels, at the region of apical meristem and the apex of cotyledons. {ECO:0000269\|PubMed:17419845}.
Uniprot	TISSUE SPECIFICITY: Expressed in stems and flower buds (PubMed:9839469). Expressed in seedlings, roots, cotyledons and apical meristems (PubMed:17419845). {ECO:0000269\|PubMed:17419845, ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
TAIR	"MYB12 belongs to subgroup 7 of the R2R3-MYB family. It strongly activates the promoters of chalcone synthase (CHS), flavanone 3-hydroxylase (F3H), flavonol synthase (FLS) and - to a lesser extent - chalcone flavanone isomerase (CHI), but cannot activate the promoters of flavonoid-3'hydroxylase (F3'H) and dihydroflavonol 4-reductase (DF). The activation requires a functional MYB recognition element (MRE). Results from the myb12-1f allele indicate that an activation domain might be present in the C-terminus. Overexpression or knock-out plants do not show any obvious phenotype under greenhouse conditions. Young myb12-ko seedlings contain reduced amounts of flavonoids (quercetin and kaempferol), while seedlings as well as leaves of MYB12-OX plants displayed an increased flavonoid content. They did not show any significant difference in anthocyanin content. Expression of CHS and FLS shows a clear correlation to MYB12 expression levels. CHI and F3H show increased transcript levels in the MYB12-OX lines, but no differences in the knock-out. Even in the absence of functional MYB12, flavonol biosynthesis is not completely absent, suggesting functional redundancy. " The redundant factors are MYB11 and MYB111 although MYB12 is primarily required for flavonol biosynthesis in roots.
UniProt	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269\|PubMed:15923334, ECO:0000269\|PubMed:17419845, ECO:0000269\|PubMed:19895401, ECO:0000269\|PubMed:20731781}.

Function -- GeneRIF ? help Back to Top
The characterization of MYB12 as a flavonol-specific activator of flavonoid biosynthesis in A. thaliana is reported. [PMID: 15923334] The quantity and diversity of flavonoids is increased by overexpressing MYB12/PAP1. Flavonoids enhances both biotic and abiotic stress tolerance in crops. [PMID: 24274116] AtMYB12 was overexpressed in a commercial cultivar of kale and the transgenic plants were tested both in in vitro and in semi-field conditions. A severalfold increase in both total phenolics content and flavonol accumulation was achieved. [PMID: 24792422] results demonstrate that modulation of primary carbon metabolism and other pathways by AtMYB12 in tomato may lead to sufficient substrate supply for enhanced content of phenolics in general and flavonols in particular. [PMID: 26206248] Results showed that AtMYB12-overexpressing Arabidopsis plants exhibited increased levels of flavonoids and enhanced salt and drought tolerance suggesting that overexpression of AtMYB12 up-regulates genes involved in flavonoid biosynthesis, abscisic acid biosynthesis, proline biosynthesis and ROS-scavenging system, resulting in significant physiological changes. [PMID: 27033553] The R2R3-MYB transcription factor MYB12 (AtMYB12) activation domain (AD) was identified in the amino acid region 273 to 325 (of 371), with the region 309-325 having the most relevant effect on activation capacity. [PMID: 28284041]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00627	PBM	Transfer from PK06182.1	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G47460.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269\|PubMed:17053893, ECO:0000269\|PubMed:19895401, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT5G11260 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT3G51240(A), AT4G15480(A), AT5G08640(A), AT5G13930(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G37260, AT1G10585, AT1G53230

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G47460

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY060588	0.0	AY060588.1 Arabidopsis thaliana At2g47460/T30B22.24 mRNA, complete cds.
GenBank	AY142067	0.0	AY142067.1 Arabidopsis thaliana At2g47460/T30B22.24 mRNA, complete cds.
GenBank	AY519580	0.0	AY519580.1 Arabidopsis thaliana MYB transcription factor (At2g47460) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_182268.1	0.0	myb domain protein 12
Swissprot	O22264	0.0	MYB12_ARATH; Transcription factor MYB12
TrEMBL	D7LGN2	0.0	D7LGN2_ARALL; Uncharacterized protein
STRING	AT2G47460.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT2G47460.1
Entrez Gene	819359
iHOP	AT2G47460
wikigenes	AT2G47460

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Hoth S, et al. Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana. FEBS Lett., 2003. 554(3): p. 373-80 [PMID:14623097] Liu F, et al. Global transcription profiling reveals comprehensive insights into hypoxic response in Arabidopsis. Plant Physiol., 2005. 137(3): p. 1115-29 [PMID:15734912] Mehrtens F,Kranz H,Bednarek P,Weisshaar B The Arabidopsis transcription factor MYB12 is a flavonol-specific regulator of phenylpropanoid biosynthesis. Plant Physiol., 2005. 138(2): p. 1083-96 [PMID:15923334] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Oravecz A, et al. CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis. Plant Cell, 2006. 18(8): p. 1975-90 [PMID:16829591] Takos AM, et al. Light-induced expression of a MYB gene regulates anthocyanin biosynthesis in red apples. Plant Physiol., 2006. 142(3): p. 1216-32 [PMID:17012405] Lea US,Slimestad R,Smedvig P,Lillo C Nitrogen deficiency enhances expression of specific MYB and bHLH transcription factors and accumulation of end products in the flavonoid pathway. Planta, 2007. 225(5): p. 1245-53 [PMID:17053893] Lee J, et al. Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development. Plant Cell, 2007. 19(3): p. 731-49 [PMID:17337630] Stracke R, et al. Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling. Plant J., 2007. 50(4): p. 660-77 [PMID:17419845] Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. Plant Physiol., 2007. 144(3): p. 1391-406 [PMID:17478635] Luo J, et al. AtMYB12 regulates caffeoyl quinic acid and flavonol synthesis in tomato: expression in fruit results in very high levels of both types of polyphenol. Plant J., 2008. 56(2): p. 316-26 [PMID:18643978] Yonekura-Sakakibara K, et al. Comprehensive flavonol profiling and transcriptome coexpression analysis leading to decoding gene-metabolite correlations in Arabidopsis. Plant Cell, 2008. 20(8): p. 2160-76 [PMID:18757557] Olsen KM, et al. Temperature and nitrogen effects on regulators and products of the flavonoid pathway: experimental and kinetic model studies. Plant Cell Environ., 2009. 32(3): p. 286-99 [PMID:19054348] Czemmel S, et al. The grapevine R2R3-MYB transcription factor VvMYBF1 regulates flavonol synthesis in developing grape berries. Plant Physiol., 2009. 151(3): p. 1513-30 [PMID:19741049] Stracke R, et al. The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation. Plant Cell Environ., 2010. 33(1): p. 88-103 [PMID:19895401] Rubin G,Tohge T,Matsuda F,Saito K,Scheible WR Members of the LBD family of transcription factors repress anthocyanin synthesis and affect additional nitrogen responses in Arabidopsis. Plant Cell, 2009. 21(11): p. 3567-84 [PMID:19933203] Misra P, et al. Modulation of transcriptome and metabolome of tobacco by Arabidopsis transcription factor, AtMYB12, leads to insect resistance. Plant Physiol., 2010. 152(4): p. 2258-68 [PMID:20190095] Stracke R, et al. Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation. New Phytol., 2010. 188(4): p. 985-1000 [PMID:20731781] Tossi V,Amenta M,Lamattina L,Cassia R Nitric oxide enhances plant ultraviolet-B protection up-regulating gene expression of the phenylpropanoid biosynthetic pathway. Plant Cell Environ., 2011. 34(6): p. 909-21 [PMID:21332509] Lewis DR, et al. Auxin and ethylene induce flavonol accumulation through distinct transcriptional networks. Plant Physiol., 2011. 156(1): p. 144-64 [PMID:21427279] Schenke D,B Crosstalk between abiotic ultraviolet-B stress and biotic (flg22) stress signalling in Arabidopsis prevents flavonol accumulation in favor of pathogen defence compound production. Plant Cell Environ., 2011. 34(11): p. 1849-64 [PMID:21707654] Park NI, et al. Enhancement of rutin in Fagopyrum esculentum hairy root cultures by the Arabidopsis transcription factor AtMYB12. Biotechnol. Lett., 2012. 34(3): p. 577-83 [PMID:22113884] Routaboul JM, et al. Metabolite profiling and quantitative genetics of natural variation for flavonoids in Arabidopsis. J. Exp. Bot., 2012. 63(10): p. 3749-64 [PMID:22442426] Pandey A,Misra P,Chandrashekar K,Trivedi PK Development of AtMYB12-expressing transgenic tobacco callus culture for production of rutin with biopesticidal potential. Plant Cell Rep., 2012. 31(10): p. 1867-76 [PMID:22733206] Brenner WG,Schm Transcript profiling of cytokinin action in Arabidopsis roots and shoots discovers largely similar but also organ-specific responses. BMC Plant Biol., 2012. 12: p. 112 [PMID:22824128] Nakatsuka T, et al. Isolation and characterization of GtMYBP3 and GtMYBP4, orthologues of R2R3-MYB transcription factors that regulate early flavonoid biosynthesis, in gentian flowers. J. Exp. Bot., 2012. 63(18): p. 6505-17 [PMID:23125348] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Tilbrook K, et al. The UVR8 UV-B Photoreceptor: Perception, Signaling and Response. Arabidopsis Book, 2013. 11: p. e0164 [PMID:23864838] Pandey A, et al. Co-expression of Arabidopsis transcription factor, AtMYB12, and soybean isoflavone synthase, GmIFS1, genes in tobacco leads to enhanced biosynthesis of isoflavones and flavonols resulting in osteoprotective activity. Plant Biotechnol. J., 2014. 12(1): p. 69-80 [PMID:24102754] Li S,Zachgo S TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana. Plant J., 2013. 76(6): p. 901-13 [PMID:24118612] Nakabayashi R, et al. Enhancement of oxidative and drought tolerance in Arabidopsis by overaccumulation of antioxidant flavonoids. Plant J., 2014. 77(3): p. 367-79 [PMID:24274116] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] L Heterologous expression of AtMYB12 in kale (Brassica oleracea var. acephala) leads to high flavonol accumulation. Plant Cell Rep., 2014. 33(8): p. 1377-88 [PMID:24792422] Lumba S, et al. A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis. Dev. Cell, 2014. 29(3): p. 360-72 [PMID:24823379] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Pandey A, et al. AtMYB12 expression in tomato leads to large scale differential modulation in transcriptome and flavonoid content in leaf and fruit tissues. Sci Rep, 2015. 5: p. 12412 [PMID:26206248] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Li Y, et al. Development of Marker-Free Transgenic Potato Tubers Enriched in Caffeoylquinic Acids and Flavonols. J. Agric. Food Chem., 2016. 64(14): p. 2932-40 [PMID:27019017] Wang F, et al. AtMYB12 regulates flavonoids accumulation and abiotic stress tolerance in transgenic Arabidopsis thaliana. Mol. Genet. Genomics, 2016. 291(4): p. 1545-59 [PMID:27033553] Zhou Z,Schenke D,Miao Y,Cai D Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings. Plant Cell Environ., 2017. 40(3): p. 453-458 [PMID:28032363] Wang N, et al. MYB12 and MYB22 play essential roles in proanthocyanidin and flavonol synthesis in red-fleshed apple (Malus sieversii f. niedzwetzkyana). Plant J., 2017. 90(2): p. 276-292 [PMID:28107780] Stracke R,Turgut-Kara N,Weisshaar B The AtMYB12 activation domain maps to a short C-terminal region of the transcription factor. Z. Naturforsch., C, J. Biosci., 2017. 72(7-8): p. 251-257 [PMID:28284041] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Hidalgo D, et al. Tailoring tobacco hairy root metabolism for the production of stilbenes. Sci Rep, 2017. 7(1): p. 17976 [PMID:29269790] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]