PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA01g24400

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

MYB

Protein Properties

Length: 278aa MW: 30919.2 Da PI: 10.1763

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA01g24400	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.6	1.8e-15	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgrWT+eEd++l +++ G g+W++ ++ g+ R++k+c++rw +yl CA01g24400 14 RGRWTAEEDQILTNYILSNGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61 8*****************************99**********97 PP
2	Myb_DNA-binding	51.9	1.8e-16	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ T +E+ +++++++ lG++ W++Ia +++ gRt++++k++w+++l CA01g24400 67 RGNITSQEENIIIKLHATLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112 7999****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.3E-21	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.964	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	2.18E-27	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.3E-10	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.7E-13	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	3.42E-8	16	61	No hit	No description
PROSITE profile	PS51294	24.778	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	3.7E-25	65	116	IPR009057	Homeodomain-like
SMART	SM00717	1.4E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-14	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	4.93E-11	71	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009813	Biological Process	flavonoid biosynthetic process
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 278 aa Download sequence Send to blast
MGRAPCCEKV GLKRGRWTAE EDQILTNYIL SNGEGSWRSL PKNAGLLRCG KSCRLRWINY 60 LRSDLKRGNI TSQEENIIIK LHATLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRKVESLR 120 IPSDEKLPQA VVDLAKKGAL MPIKQSRKTS RISNMKKNKT SKNSNLAEPK EAKENSTSGP 180 LSASAVSIPS TLNMEKEALS STISSWLDGK NMPASDSAMD SMQEDVADVA APNPRVGSRE 240 SHSSLSSGKL FIFLSYYVRL CMYGSSFFNN RYDMERT*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-24	12	118	5	110	B-MYB
1h8a_C	5e-24	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269\|PubMed:15923334, ECO:0000269\|PubMed:17419845, ECO:0000269\|PubMed:19895401, ECO:0000269\|PubMed:20731781}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00627	PBM	Transfer from PK06182.1	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269\|PubMed:17053893, ECO:0000269\|PubMed:19895401, ECO:0000269\|PubMed:9839469}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016557269.1	1e-177	PREDICTED: myb-related protein Myb4-like isoform X1
Refseq	XP_016557274.1	1e-177	PREDICTED: myb-related protein Myb4-like isoform X2
Swissprot	O22264	9e-76	MYB12_ARATH; Transcription factor MYB12
TrEMBL	A0A1U8FND9	1e-175	A0A1U8FND9_CAPAN; myb-related protein Myb4-like isoform X1
TrEMBL	A0A1U8FNE4	1e-176	A0A1U8FNE4_CAPAN; Transcription repressor MYB6
TrEMBL	A0A2G3AL08	1e-176	A0A2G3AL08_CAPAN; myb-related protein Myb4-like isoform X2
STRING	XP_009622107.1	1e-129	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47460.1	3e-77	myb domain protein 12

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Pandey A, et al. Co-expression of Arabidopsis transcription factor, AtMYB12, and soybean isoflavone synthase, GmIFS1, genes in tobacco leads to enhanced biosynthesis of isoflavones and flavonols resulting in osteoprotective activity. Plant Biotechnol. J., 2014. 12(1): p. 69-80 [PMID:24102754] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Pandey A, et al. AtMYB12 expression in tomato leads to large scale differential modulation in transcriptome and flavonoid content in leaf and fruit tissues. Sci Rep, 2015. 5: p. 12412 [PMID:26206248] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Li Y, et al. Development of Marker-Free Transgenic Potato Tubers Enriched in Caffeoylquinic Acids and Flavonols. J. Agric. Food Chem., 2016. 64(14): p. 2932-40 [PMID:27019017] Zhou Z,Schenke D,Miao Y,Cai D Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings. Plant Cell Environ., 2017. 40(3): p. 453-458 [PMID:28032363] Wang N, et al. MYB12 and MYB22 play essential roles in proanthocyanidin and flavonol synthesis in red-fleshed apple (Malus sieversii f. niedzwetzkyana). Plant J., 2017. 90(2): p. 276-292 [PMID:28107780] Stracke R,Turgut-Kara N,Weisshaar B The AtMYB12 activation domain maps to a short C-terminal region of the transcription factor. Z. Naturforsch., C, J. Biosci., 2017. 72(7-8): p. 251-257 [PMID:28284041] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Hidalgo D, et al. Tailoring tobacco hairy root metabolism for the production of stilbenes. Sci Rep, 2017. 7(1): p. 17976 [PMID:29269790]