PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009111619.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 248aa MW: 28583.1 Da PI: 9.7516 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.8 | 1.8e-16 | 38 | 85 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd l d+v+ +G+g+W++I r+ g++R++k+c++rw +yl XP_009111619.1 38 KGLWTVEEDNVLMDYVQTHGKGHWNRIVRKTGLKRCGKSCRLRWINYL 85 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 62.1 | 1.2e-19 | 91 | 136 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l XP_009111619.1 91 KGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNHWNTHL 136 79********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.171 | 33 | 85 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.01E-31 | 36 | 132 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.2E-13 | 37 | 87 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.5E-14 | 38 | 85 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-23 | 39 | 92 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.04E-10 | 41 | 85 | No hit | No description |
PROSITE profile | PS51294 | 27.686 | 86 | 140 | IPR017930 | Myb domain |
SMART | SM00717 | 6.1E-19 | 90 | 138 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-18 | 91 | 136 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.19E-14 | 93 | 136 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-26 | 93 | 139 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
MNGILSLYHT NKQNKSENQR IRTRTRSEKG ENHQEYKKGL WTVEEDNVLM DYVQTHGKGH 60 WNRIVRKTGL KRCGKSCRLR WINYLSPSVN KGNFTEQEED LIIRLHKLLG NRWSLIAKRV 120 PGRTDNQVKN HWNTHLSKKF VGDYSSGVKT TGENKASLLL ATASSRQHQQ DKICDKSFDG 180 LVPASYENKP NADLTHRNVV VGNTNDPSLY LKERNIFDSS NAFWFNEDEF ELMSSLAMMD 240 FASGDIGY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-28 | 35 | 140 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves primordia. Becomes more prominent in developing trichome cells but disappears progressively when trichomes begin to initiate branches. {ECO:0000269|PubMed:15728674}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves, stems and flowers (PubMed:11437443). Expressed in trichome cells and in leaf primordia (PubMed:9625690). {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:9625690}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269|PubMed:11063707, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15728674, ECO:0000269|PubMed:9625690}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009111619.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:9625690}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LC142712 | 0.0 | LC142712.1 Brassica rapa subsp. nipposinica GL1 mRNA for trichome differentiation protein GL1, complete cds, cultivar: Kyo-mizore. | |||
GenBank | LC142713 | 0.0 | LC142713.1 Brassica rapa subsp. nipposinica GL1 mRNA for trichome differentiation protein GL1, complete cds, cultivar: Kyo-nishiki. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013725063.1 | 1e-171 | trichome differentiation protein GL1-like | ||||
Swissprot | P27900 | 1e-109 | GL1_ARATH; Trichome differentiation protein GL1 | ||||
TrEMBL | A0A397XQG7 | 1e-170 | A0A397XQG7_BRACM; Uncharacterized protein | ||||
STRING | Bra039065.1-P | 1e-148 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27920.1 | 1e-111 | myb domain protein 0 |