PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009108019.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 260aa MW: 29695.8 Da PI: 9.3069 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.5 | 1.1e-16 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT +Ed++l+d++ +G g W+t ++ g++R++k+c++rw +yl XP_009108019.1 17 RGAWTDQEDKILKDYIMFHGEGKWSTLPNQAGLKRCGKSCRLRWKNYL 64 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.4 | 1.2e-16 | 70 | 114 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ XP_009108019.1 70 RGNISSDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNHWNSN 114 78999*****************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.6E-22 | 9 | 67 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.384 | 12 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.49E-28 | 15 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-12 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-14 | 17 | 64 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.23E-9 | 19 | 64 | No hit | No description |
PROSITE profile | PS51294 | 24.564 | 65 | 119 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-23 | 68 | 119 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-15 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-14 | 70 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.28E-10 | 74 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006633 | Biological Process | fatty acid biosynthetic process | ||||
GO:0006970 | Biological Process | response to osmotic stress | ||||
GO:0010023 | Biological Process | proanthocyanidin biosynthetic process | ||||
GO:0090379 | Biological Process | secondary cell wall biogenesis involved in seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 260 aa Download sequence Send to blast |
MMRKRESSKV KKEELNRGAW TDQEDKILKD YIMFHGEGKW STLPNQAGLK RCGKSCRLRW 60 KNYLRPGIKR GNISSDEEEL IIRLHNLLGN RWSLIAGRLP GRTDNEIKNH WNSNLRKRLP 120 KSQTNQQKSR KHSNNNNMNK VCVIRPKAIR FPKALTFQNQ SSIGSTSLLT VKENVIDHQA 180 GSPSLLGDLK IDFDKIQSEY LFSDLMDFDG LGCGNVMSLV SSDEVLGDYV SADTSCLGNL 240 DLNRPFTSCL QEDCLWDFNC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-27 | 8 | 119 | 18 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009108019.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM975664 | 0.0 | KM975664.1 Brassica napus MYB transcription factor 123-1.1 (MYB123-1.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009108019.1 | 0.0 | PREDICTED: transcription factor TT2 | ||||
Swissprot | Q9FJA2 | 1e-127 | TT2_ARATH; Transcription factor TT2 | ||||
TrEMBL | A0A0N7AML8 | 0.0 | A0A0N7AML8_BRANA; MYB transcription factor 123-1.1 | ||||
TrEMBL | A0A397Y9E9 | 0.0 | A0A397Y9E9_BRACM; Uncharacterized protein | ||||
TrEMBL | M4F382 | 0.0 | M4F382_BRARP; Uncharacterized protein | ||||
STRING | Bra035532.1-P | 0.0 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35550.1 | 1e-124 | MYB family protein |