PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00101158001

Common Name

GSBRNA2T00101158001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB

Protein Properties

Length: 233aa MW: 26634.7 Da PI: 7.2367

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00101158001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.5	7.5e-19	21	68	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv+ v +G +W+ Iar g++Rt+k+c++rw++yl GSBRNA2T00101158001 21 KGPWTEEEDAILVNFVSIHGDARWNHIARSSGLKRTGKSCRLRWLNYL 68 79********************************************97 PP
2	Myb_DNA-binding	48.7	1.7e-15	74	117	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T eE++ +++++ ++G++ W++Ia++++ gRt++++k++w++ GSBRNA2T00101158001 74 RGNITLEEQLMILKLHSLWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117 7999****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.95	16	72	IPR017930	Myb domain
SuperFamily	SSF46689	5.99E-31	18	115	IPR009057	Homeodomain-like
SMART	SM00717	5.1E-16	20	70	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-16	21	68	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.7E-23	22	75	IPR009057	Homeodomain-like
CDD	cd00167	9.20E-13	23	68	No hit	No description
PROSITE profile	PS51294	19.135	73	123	IPR017930	Myb domain
SMART	SM00717	4.0E-14	73	121	IPR001005	SANT/Myb domain
Pfam	PF00249	3.6E-14	74	117	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-22	76	122	IPR009057	Homeodomain-like
CDD	cd00167	4.51E-11	78	117	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 233 aa Download sequence Send to blast
MEDYERNSNS PAHEEDSDVR KGPWTEEEDA ILVNFVSIHG DARWNHIARS SGLKRTGKSC 60 RLRWLNYLRP DVRRGNITLE EQLMILKLHS LWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ 120 KQAKHLRCDV NSNLFKETMK NVWMPRLVER INAQTPSPTY EQVESMVTDP SQSIDEPSPV 180 EPGFVQFNRN HHCHQQQFVP ASDVSATSSN SPAETSGGAT LLRGGSTDPC DF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-26	18	123	4	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269\|PubMed:22301384}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00101158001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ144191	0.0	KJ144191.1 Brassica rapa subsp. chinensis MYB transcription factor (MYB) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013674394.1	1e-172	transcription factor MYB78-like
Swissprot	Q10MB4	7e-77	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	A0A397Z7E1	1e-150	A0A397Z7E1_BRACM; Uncharacterized protein
TrEMBL	M4CJT9	1e-150	M4CJT9_BRARP; Uncharacterized protein
STRING	Bra004473.1-P	1e-151	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47190.1	1e-144	myb domain protein 2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]