PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G47190.1

Common Name

ATMYB2, MYB2

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 273aa MW: 31447.8 Da PI: 5.1993

Description

myb domain protein 2

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G47190.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.1	9.7e-19	22	69	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv+ v +G +W+ Iar g++Rt+k+c++rw++yl AT2G47190.1 22 KGPWTEEEDAILVNFVSIHGDARWNHIARSSGLKRTGKSCRLRWLNYL 69 79********************************************97 PP
2	Myb_DNA-binding	46.8	6.9e-15	75	118	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T eE+ +++++ ++G++ W++Ia++++ gRt++++k++w++ AT2G47190.1 75 RGNITLEEQFMILKLHSLWGNR-WSKIAQYLP-GRTDNEIKNYWRT 118 7899****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.95	17	73	IPR017930	Myb domain
SuperFamily	SSF46689	1.09E-30	19	116	IPR009057	Homeodomain-like
SMART	SM00717	5.1E-16	21	71	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-16	22	69	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-22	23	76	IPR009057	Homeodomain-like
CDD	cd00167	1.94E-12	24	69	No hit	No description
SMART	SM00717	1.1E-13	74	122	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	18.098	74	124	IPR017930	Myb domain
Pfam	PF00249	1.8E-13	75	118	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.2E-22	77	123	IPR009057	Homeodomain-like
CDD	cd00167	2.00E-10	79	118	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0016036	Biological Process	cellular response to phosphate starvation
GO:0030154	Biological Process	cell differentiation
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0046686	Biological Process	response to cadmium ion
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001046	Molecular Function	core promoter sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0005516	Molecular Function	calmodulin binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009047	anatomy	stem
PO:0025281	anatomy	pollen
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 273 aa Download sequence Send to blast
MEDYERINSN SPTHEEDSDV RKGPWTEEED AILVNFVSIH GDARWNHIAR SSGLKRTGKS 60 CRLRWLNYLR PDVRRGNITL EEQFMILKLH SLWGNRWSKI AQYLPGRTDN EIKNYWRTRV 120 QKQAKHLRCD VNSNLFKETM RNVWMPRLVE RINAQSLPTT CEQVESMITD PSQPVNEPSP 180 VEPGFVQFSQ NHHQQFVPAT ELSATSSNSP AETFSDVRGG VVNGSGYDPS GQTGFGEFND 240 WGCVGGDNMW TDEESFWFLQ DQFCPDTTSY SYN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	6e-26	19	124	4	108	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.36396	0.0	leaf

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	260581_at	0.0
Expression Atlas	AT2G47190	-
AtGenExpress	AT2G47190	-
ATTED-II	AT2G47190	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a MYB transcription factor that possesses an R2R3 MYB DNA binding domain and is known to regulate the expression of salt- and dehydration-responsive genes. Has been shown to bind calmodulin.

Function -- GeneRIF ? help Back to Top
a specific CaM isoform mediates salt-induced Ca2+ signaling through the activation of an MYB transcriptional activator, thereby resulting in salt tolerance in plants. [PMID: 15569682] MYB2 is involved in iron translocation from roots to shoots. [PMID: 17031393] Results demonstrate that the DNA-binding domain of AtMYB2 is inhibited by S-nitrosylation of Cys53 as a consequence of nitric oxide action. [PMID: 17686455] An AtMYB2-regulated post apical dominance mechanism by which Arabidopsis (Arabidopsis thaliana) inhibits the outgrowth of axillary buds as part of the whole plant senescence program, is reported. [PMID: 21543729] The AtMYB2 transcription factor can therefore interact with the choline monooxygenase promoter directly and regulate its downstream gene expression. [PMID: 22714268] AtMYB2 regulates plant responses to phosphate starvation by regulating the expression of the miR399 gene. [PMID: 23154535]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G47190.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G77120(A), AT5G25610(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, ethylene, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G32640

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G47190

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK229140	0.0	AK229140.1 Arabidopsis thaliana mRNA for MYB transcription factor, complete cds, clone: RAFL16-42-L19.
GenBank	AY519579	0.0	AY519579.1 Arabidopsis thaliana MYB transcription factor (At2g47190) mRNA, complete cds.
GenBank	BT010949	0.0	BT010949.1 Arabidopsis thaliana At2g47190 gene, complete cds.
GenBank	BT011656	0.0	BT011656.1 Arabidopsis thaliana At2g47190 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_182241.1	0.0	myb domain protein 2
TrEMBL	A0A178VX63	0.0	A0A178VX63_ARATH; MYB2
TrEMBL	Q39028	0.0	Q39028_ARATH; ATMYB2
STRING	AT2G47190.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT2G47190.1
Entrez Gene	819332
iHOP	AT2G47190
wikigenes	AT2G47190

Publications ? help Back to Top
Dennis ES, et al. Molecular strategies for improving waterlogging tolerance in plants. J. Exp. Bot., 2000. 51(342): p. 89-97 [PMID:10938799] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Xiong L,Schumaker KS,Zhu JK Cell signaling during cold, drought, and salt stress. Plant Cell, 2002. 14 Suppl: p. S165-83 [PMID:12045276] Zheng ZL, et al. Plasma membrane-associated ROP10 small GTPase is a specific negative regulator of abscisic acid responses in Arabidopsis. Plant Cell, 2002. 14(11): p. 2787-97 [PMID:12417701] Abe H, et al. Arabidopsis AtMYC2 (bHLH) and AtMYB2 (MYB) function as transcriptional activators in abscisic acid signaling. Plant Cell, 2003. 15(1): p. 63-78 [PMID:12509522] Kamiya T,Kawabe A,Miyashita NT Nucleotide polymorphism at the Atmyb2 locus of the wild plant Arabidopsis thaliana. Genet. Res., 2002. 80(2): p. 89-98 [PMID:12534212] Heim MA, et al. The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity. Mol. Biol. Evol., 2003. 20(5): p. 735-47 [PMID:12679534] Bae MS,Cho EJ,Choi EY,Park OK Analysis of the Arabidopsis nuclear proteome and its response to cold stress. Plant J., 2003. 36(5): p. 652-63 [PMID:14617066] Villalobos MA,Bartels D,Iturriaga G Stress tolerance and glucose insensitive phenotypes in Arabidopsis overexpressing the CpMYB10 transcription factor gene. Plant Physiol., 2004. 135(1): p. 309-24 [PMID:15122027] Lorenzo O,Chico JM,S JASMONATE-INSENSITIVE1 encodes a MYC transcription factor essential to discriminate between different jasmonate-regulated defense responses in Arabidopsis. Plant Cell, 2004. 16(7): p. 1938-50 [PMID:15208388] Wang S, et al. Control of plant trichome development by a cotton fiber MYB gene. Plant Cell, 2004. 16(9): p. 2323-34 [PMID:15316114] Anderson JP, et al. Antagonistic interaction between abscisic acid and jasmonate-ethylene signaling pathways modulates defense gene expression and disease resistance in Arabidopsis. Plant Cell, 2004. 16(12): p. 3460-79 [PMID:15548743] Sell S,Hehl R Functional dissection of a small anaerobically induced bZIP transcription factor from tomato. Eur. J. Biochem., 2004. 271(22): p. 4534-44 [PMID:15560794] Yoo JH, et al. Direct interaction of a divergent CaM isoform and the transcription factor, MYB2, enhances salt tolerance in arabidopsis. J. Biol. Chem., 2005. 280(5): p. 3697-706 [PMID:15569682] Mohanty B,Krishnan SP,Swarup S,Bajic VB Detection and preliminary analysis of motifs in promoters of anaerobically induced genes of different plant species. Ann. Bot., 2005. 96(4): p. 669-81 [PMID:16027132] Xin Z,Zhao Y,Zheng ZL Transcriptome analysis reveals specific modulation of abscisic acid signaling by ROP10 small GTPase in Arabidopsis. Plant Physiol., 2005. 139(3): p. 1350-65 [PMID:16258012] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Chen YH,Wu XM,Ling HQ,Yang WC Transgenic expression of DwMYB2 impairs iron transport from root to shoot in Arabidopsis thaliana. Cell Res., 2006. 16(10): p. 830-40 [PMID:17031393] Shinozaki K,Yamaguchi-Shinozaki K Gene networks involved in drought stress response and tolerance. J. Exp. Bot., 2007. 58(2): p. 221-7 [PMID:17075077] Serpa V, et al. Inhibition of AtMYB2 DNA-binding by nitric oxide involves cysteine S-nitrosylation. Biochem. Biophys. Res. Commun., 2007. 361(4): p. 1048-53 [PMID:17686455] Papdi C, et al. Functional identification of Arabidopsis stress regulatory genes using the controlled cDNA overexpression system. Plant Physiol., 2008. 147(2): p. 528-42 [PMID:18441225] Shangguan XX,Xu B,Yu ZX,Wang LJ,Chen XY Promoter of a cotton fibre MYB gene functional in trichomes of Arabidopsis and glandular trichomes of tobacco. J. Exp. Bot., 2008. 59(13): p. 3533-42 [PMID:18711121] Guo Y,Gan S AtMYB2 regulates whole plant senescence by inhibiting cytokinin-mediated branching at late stages of development in Arabidopsis. Plant Physiol., 2011. 156(3): p. 1612-9 [PMID:21543729] Rushton DL, et al. WRKY transcription factors: key components in abscisic acid signalling. Plant Biotechnol. J., 2012. 10(1): p. 2-11 [PMID:21696534] Yu L, et al. AtMYB2 transcription factor can interact with the CMO promoter and regulate its downstream gene expression. Biotechnol. Lett., 2012. 34(9): p. 1749-55 [PMID:22714268] Baek D, et al. Regulation of miR399f transcription by AtMYB2 affects phosphate starvation responses in Arabidopsis. Plant Physiol., 2013. 161(1): p. 362-73 [PMID:23154535] Baek D,Park HC,Kim MC,Yun DJ The role of Arabidopsis MYB2 in miR399f-mediated phosphate-starvation response. Plant Signal Behav, 2013. 8(3): p. e23488 [PMID:23333957] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Urao T,Yamaguchi-Shinozaki K,Urao S,Shinozaki K An Arabidopsis myb homolog is induced by dehydration stress and its gene product binds to the conserved MYB recognition sequence. Plant Cell, 1993. 5(11): p. 1529-39 [PMID:8312738] Urao T,Noji M,Yamaguchi-Shinozaki K,Shinozaki K A transcriptional activation domain of ATMYB2, a drought-inducible Arabidopsis Myb-related protein. Plant J., 1996. 10(6): p. 1145-8 [PMID:9011094] Abe H, et al. Role of arabidopsis MYC and MYB homologs in drought- and abscisic acid-regulated gene expression. Plant Cell, 1997. 9(10): p. 1859-68 [PMID:9368419] Hoeren FU,Dolferus R,Wu Y,Peacock WJ,Dennis ES Evidence for a role for AtMYB2 in the induction of the Arabidopsis alcohol dehydrogenase gene (ADH1) by low oxygen. Genetics, 1998. 149(2): p. 479-90 [PMID:9611167]