PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00004078001
Common NameGSBRNA2T00004078001
Organism
Brassica napus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 96aa    MW: 11068.7 Da    PI: 9.8186
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00004078001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg WT eEd++lv +++++G g+W+  +r+ g+ R++k+c++rw++yl
  GSBRNA2T00004078001 14 RGGWTDEEDQKLVAYINEYGIGDWRFLPRKAGLQRCGKSCRLRWLNYL 61
                         789********************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.801965IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-211064IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
SuperFamilySSF466898.45E-231589IPR009057Homeodomain-like
CDDcd001678.12E-111761No hitNo description
PROSITE profilePS500903.9036289IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.2E-86589IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MGRATWFDAD GTKRGGWTDE EDQKLVAYIN EYGIGDWRFL PRKAGLQRCG KSCRLRWLNY  60
LRPGVKKGKF TPEEEEAIIN FQSILGNRYI NKLII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-161494788B-MYB
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in rosette leaves, cauline leaves and flowers. {ECO:0000269|PubMed:8980549}.
UniprotTISSUE SPECIFICITY: Expressed in trichomes, stems, carpels, petals and stamens. {ECO:0000269|PubMed:18805951}.
Functional Description ? help Back to Top
Source Description
UniProtFunctions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}.
UniProtProbable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00004078001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638895.15e-60PREDICTED: transcription repressor MYB6-like isoform X1
RefseqXP_013638896.12e-60PREDICTED: transcription factor MYB32-like isoform X2
SwissprotQ9LDR88e-37MY102_ARATH; Transcription factor MYB102
SwissprotQ9LE637e-37MY106_ARATH; Transcription factor MYB106
TrEMBLA0A078IKZ01e-63A0A078IKZ0_BRANA; BnaC05g50190D protein
TrEMBLA0A397YXM31e-63A0A397YXM3_BRACM; Uncharacterized protein
STRINGBo5g025790.12e-59(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.15e-48myb domain protein 47
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]
  5. Zhu L,Guo J,Ma Z,Wang J,Zhou C
    Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis.
    Biomolecules, 2019.
    [PMID:29880735]