PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIDC4BG055130.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 49aa MW: 5470.32 Da PI: 4.8096 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 28.5 | 4.2e-09 | 18 | 46 | 3 | 32 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkklelee 32 pGfrFhPt+eel+ +yL + + gkkl++ + TRIDC4BG055130.1 18 PGFRFHPTEEELLGFYLSRVALGKKLHF-D 46 9**********************99887.4 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 49 aa Download sequence |
MAMAAAASPT MEFDQDLPGF RFHPTEEELL GFYLSRVALG KKLHFDIIG |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 1e-11 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Ensembl | TRIDC4BG055130.1 |