Signature Domain? help Back to Top |
![Signature Domain](draw_signature_domain.php?sp=Ath&pid=AT2G17040.1) |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 150.5 | 7.9e-47 | 8 | 134 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98
pGfrFhPt+eel+++yLk+ v gk+ ++ evi ++iy+++PwdLp + +e+ewyfF++r++k+ +g r++r+t++gyWkatg+d++++s ++
AT2G17040.1 8 PGFRFHPTEEELLDFYLKNMVYGKRSSV-EVIGFLNIYRHDPWDLPGLSRIGEREWYFFVPRERKHGNGGRPSRTTEKGYWKATGSDRKIISLsePKR 104
9************************999.99***************7777899*************************************98755777 PP
NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128
++glkktLvfy+grap g+ktdWvm+e+r+
AT2G17040.1 105 VIGLKKTLVFYRGRAPGGSKTDWVMNEFRM 134
8***************************97 PP
|
3D Structure ? help Back to Top |
![Structure](draw_protein_structure.php?sp=Ath&pid=AT2G17040.1) |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1ut4_A | 1e-44 | 8 | 155 | 19 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-44 | 8 | 155 | 19 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-44 | 8 | 155 | 19 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-44 | 8 | 155 | 19 | 168 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-45 | 8 | 155 | 22 | 171 | NAC domain-containing protein 19 |
3swm_B | 8e-45 | 8 | 155 | 22 | 171 | NAC domain-containing protein 19 |
3swm_C | 8e-45 | 8 | 155 | 22 | 171 | NAC domain-containing protein 19 |
3swm_D | 8e-45 | 8 | 155 | 22 | 171 | NAC domain-containing protein 19 |
3swp_A | 8e-45 | 8 | 155 | 22 | 171 | NAC domain-containing protein 19 |
3swp_B | 8e-45 | 8 | 155 | 22 | 171 | NAC domain-containing protein 19 |
3swp_C | 8e-45 | 8 | 155 | 22 | 171 | NAC domain-containing protein 19 |
3swp_D | 8e-45 | 8 | 155 | 22 | 171 | NAC domain-containing protein 19 |
4dul_A | 1e-44 | 8 | 155 | 19 | 168 | NAC domain-containing protein 19 |
4dul_B | 1e-44 | 8 | 155 | 19 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Ooka H, et al.
Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] - Goda H, et al.
Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. Plant Physiol., 2004. 134(4): p. 1555-73 [PMID:15047898] - Ko JH,Han KH,Park S,Yang J
Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] - Hampton CR, et al.
Cesium toxicity in Arabidopsis. Plant Physiol., 2004. 136(3): p. 3824-37 [PMID:15489280] - Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S
Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis. J. Agric. Food Chem., 2005. 53(4): p. 1022-30 [PMID:15713015] - Xin Z,Zhao Y,Zheng ZL
Transcriptome analysis reveals specific modulation of abscisic acid signaling by ROP10 small GTPase in Arabidopsis. Plant Physiol., 2005. 139(3): p. 1350-65 [PMID:16258012] - Mosher RA,Durrant WE,Wang D,Song J,Dong X
A comprehensive structure-function analysis of Arabidopsis SNI1 defines essential regions and transcriptional repressor activity. Plant Cell, 2006. 18(7): p. 1750-65 [PMID:16766691] - Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. Plant Physiol., 2007. 144(3): p. 1391-406 [PMID:17478635] - Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] - Meier S, et al.
Co-expression and promoter content analyses assign a role in biotic and abiotic stress responses to plant natriuretic peptides. BMC Plant Biol., 2008. 8: p. 24 [PMID:18307823] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Kato H,Motomura T,Komeda Y,Saito T,Kato A
Overexpression of the NAC transcription factor family gene ANAC036 results in a dwarf phenotype in Arabidopsis thaliana. J. Plant Physiol., 2010. 167(7): p. 571-7 [PMID:19962211] - Hong Y,Zhang H,Huang L,Li D,Song F
Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]
|