![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp4g11440 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 150aa MW: 16723.3 Da PI: 8.3052 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30.7 | 5.2e-10 | 6 | 47 | 2 | 38 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....T CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....g 38 ++R+++t+eql +Lee++++ r+p+a ++++++++l + Tp4g11440 6 STRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygR 47 58*****************99**************9955553 PP | |||||||
2 | Wus_type_Homeobox | 74.8 | 1.3e-24 | 5 | 52 | 2 | 49 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkN 49 a+tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kN Tp4g11440 5 ASTRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKN 52 589********************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00046 | 1.1E-7 | 7 | 47 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008283 | Biological Process | cell proliferation | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0009943 | Biological Process | adaxial/abaxial axis specification | ||||
GO:0009947 | Biological Process | centrolateral axis specification | ||||
GO:0010865 | Biological Process | stipule development | ||||
GO:0048513 | Biological Process | animal organ development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MSPVASTRWC PTPEQLMILE EMYRSGIRTP NAVQIQQITA HLAFYGRIEG KNGIGVEAQS 60 KVVNEYYCNK SGPEEMLMQK PITGQNSSSY GRDWMMMMDM GPRPSYPSSS SSSSPVPCCN 120 MMMNSPKIPL KTLELFPISS INSKQDSTKL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp4g11440 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189432 | 2e-91 | AC189432.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068E07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009133866.1 | 6e-50 | PREDICTED: WUSCHEL-related homeobox 3-like | ||||
Refseq | XP_013740679.1 | 6e-50 | WUSCHEL-related homeobox 3 | ||||
Swissprot | Q9SIB4 | 5e-37 | WOX3_ARATH; WUSCHEL-related homeobox 3 | ||||
TrEMBL | A0A398A561 | 2e-49 | A0A398A561_BRACM; Uncharacterized protein | ||||
STRING | Bra000484.1-P | 2e-49 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7480 | 26 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28610.1 | 3e-39 | WOX family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|