Signature Domain? help Back to Top |
![Signature Domain](draw_signature_domain.php?sp=Ath&pid=AT2G28610.1) |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 62.2 | 7.6e-20 | 6 | 66 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
++R+++t+eql +Lee++++ r+p+a ++++++++l +++ ++V++WFqN++a++++
AT2G28610.1 6 STRWCPTPEQLMILEEMYRSgIRTPNAVQIQQITAHLafygRIEGKNVFYWFQNHKARDRQ 66
58*****************99*************************************996 PP
|
2 | Wus_type_Homeobox | 120.2 | 8.9e-39 | 5 | 67 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
a+tRW+PtpeQ++iLee+y+sG+rtPn+ +iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk
AT2G28610.1 5 ASTRWCPTPEQLMILEEMYRSGIRTPNAVQIQQITAHLAFYGRIEGKNVFYWFQNHKARDRQK 67
589***********************************************************9 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Matsumoto N,Okada K
A homeobox gene, PRESSED FLOWER, regulates lateral axis-dependent development of Arabidopsis flowers. Genes Dev., 2001. 15(24): p. 3355-64 [PMID:11751640] - Haecker A, et al.
Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana. Development, 2004. 131(3): p. 657-68 [PMID:14711878] - Nardmann J,Ji J,Werr W,Scanlon MJ
The maize duplicate genes narrow sheath1 and narrow sheath2 encode a conserved homeobox gene function in a lateral domain of shoot apical meristems. Development, 2004. 131(12): p. 2827-39 [PMID:15169755] - Dai M,Hu Y,Zhao Y,Liu H,Zhou DX
A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant Physiol., 2007. 144(1): p. 380-90 [PMID:17351053] - Shimizu R, et al.
Tissue specificity and evolution of meristematic WOX3 function. Plant Physiol., 2009. 149(2): p. 841-50 [PMID:19073779] - Karim MR,Hirota A,Kwiatkowska D,Tasaka M,Aida M
A role for Arabidopsis PUCHI in floral meristem identity and bract suppression. Plant Cell, 2009. 21(5): p. 1360-72 [PMID:19482972] - Dai M,Hu Y,Zhao Y,Zhou DX
Regulatory Networks Involving YABBY Genes in Rice Shoot Development. Plant Signal Behav, 2007. 2(5): p. 399-400 [PMID:19704613] - Vandenbussche M, et al.
Differential recruitment of WOX transcription factors for lateral development and organ fusion in Petunia and Arabidopsis. Plant Cell, 2009. 21(8): p. 2269-83 [PMID:19717616] - Ji J,Shimizu R,Sinha N,Scanlon MJ
Analyses of WOX4 transgenics provide further evidence for the evolution of the WOX gene family during the regulation of diverse stem cell functions. Plant Signal Behav, 2010. 5(7): p. 916-20 [PMID:20495368] - Hirakawa Y,Kondo Y,Fukuda H
TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis. Plant Cell, 2010. 22(8): p. 2618-29 [PMID:20729381] - Zhang X,Zong J,Liu J,Yin J,Zhang D
Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar. J Integr Plant Biol, 2010. 52(11): p. 1016-26 [PMID:20977659] - Nakata M, et al.
Roles of the middle domain-specific WUSCHEL-RELATED HOMEOBOX genes in early development of leaves in Arabidopsis. Plant Cell, 2012. 24(2): p. 519-35 [PMID:22374393] - Nakata M,Okada K
The three-domain model: a new model for the early development of leaves in Arabidopsis thaliana. Plant Signal Behav, 2012. 7(11): p. 1423-7 [PMID:22951404] - Cho SH, et al.
The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development. New Phytol., 2013. 198(4): p. 1071-84 [PMID:23551229] - Chandler JW,Werr W
Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation. J. Exp. Bot., 2014. 65(12): p. 3097-110 [PMID:24744428] - Niu L, et al.
LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula. Plant J., 2015. 81(3): p. 480-92 [PMID:25492397] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] - Guan C, et al.
Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis. Curr. Biol., 2017. 27(19): p. 2940-2950.e4 [PMID:28943086]
|